BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00591 (382 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81518-1|CAB04214.3| 601|Caenorhabditis elegans Hypothetical pr... 27 4.5 U29537-8|ABS83848.1| 258|Caenorhabditis elegans Hypothetical pr... 27 6.0 >Z81518-1|CAB04214.3| 601|Caenorhabditis elegans Hypothetical protein F28D9.1 protein. Length = 601 Score = 27.1 bits (57), Expect = 4.5 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = +1 Query: 1 RHEDARMLRF*VTSVLLMNSSTSPKTRHYGS-SRSINGAFRYHKHRSPSSPNPSLATKGS 177 RHE+A + + + SV S SP+ R S S+S A R SP P A S Sbjct: 279 RHEEAELRQKAIASVAARAKSGSPRRRRSPSASKSPPPARRRRSPSQSKSPAPKRAKSRS 338 Query: 178 TS 183 S Sbjct: 339 KS 340 >U29537-8|ABS83848.1| 258|Caenorhabditis elegans Hypothetical protein F28B12.1b protein. Length = 258 Score = 26.6 bits (56), Expect = 6.0 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 94 SRSINGAFRYHKHRSPSSPNPSLATKGSTSELTYR 198 +RS + +H+ +PS P+PS++ S S+ T+R Sbjct: 6 ARSFQISITFHRMSAPS-PSPSISRLNSNSDETFR 39 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,451,432 Number of Sequences: 27780 Number of extensions: 128667 Number of successful extensions: 343 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 343 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 567749674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -