BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00587 (732 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 24 1.7 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 5.2 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 9.0 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 9.0 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 23.8 bits (49), Expect = 1.7 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 14 EITLMTPHNMLTAVKRFFYTVECQRSKHIFQKKPL 118 E + T +LT KRF ++E + KH K+ L Sbjct: 80 ETSRHTTLGLLTKAKRFIKSLEERERKHAVHKEQL 114 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 672 SCLGTRRAACRGL*IKNIEKAVSY 601 S L A RGL IKN+ ++Y Sbjct: 503 SILVATAVAARGLDIKNVSHVINY 526 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +1 Query: 607 YSLFYVFDSQPTTSGASSSQTTLNRSN 687 YSL + PTT ++++ TT+++ + Sbjct: 376 YSLVPTTTASPTTEPSTTTSTTISQKH 402 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 378 GIISFFFGNPITILYNVSISNHPLSYTN 461 GI+ + LY ++S+H L+Y N Sbjct: 249 GILGMALSHKTQNLYYSAMSSHNLNYVN 276 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,560 Number of Sequences: 438 Number of extensions: 5047 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -