BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00587 (732 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16830.1 68418.m01972 syntaxin 21 (SYP21) / PEP12 homolog ide... 29 4.2 At5g53390.1 68418.m06634 expressed protein 28 7.3 At1g72090.1 68414.m08333 radical SAM domain-containing protein /... 28 7.3 At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transfera... 27 9.7 >At5g16830.1 68418.m01972 syntaxin 21 (SYP21) / PEP12 homolog identical to Syntaxin homolog (PEP12 homolog) (SP:Q39233) and syntaxin of plants 21 (GP:899122) {Arabidopsis thaliana}; contains Pfam profiles PF05739:SNARE domain and PF00804: Syntaxin Length = 279 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = -1 Query: 306 LSSQLDDSKILTTEN*VNV--AEVTSLSNSVINCLLLTYF 193 +SS LD+S TT+ V + A T SNS + CLL+ F Sbjct: 227 ISSNLDNSHAATTQATVQLRKAAKTQRSNSSLTCLLILIF 266 >At5g53390.1 68418.m06634 expressed protein Length = 486 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +3 Query: 291 QVVNSNGYFFLARRVC*ISTGIQLLSEPIGIISFFFGNPITILYNVSISNHPLSYTNP-V 467 + V S +F L +V + + L+ + I + F N + ++ HPL+Y +P V Sbjct: 367 EAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGHPLNYISPCV 426 Query: 468 LGY 476 G+ Sbjct: 427 FGH 429 >At1g72090.1 68414.m08333 radical SAM domain-containing protein / TRAM domain-containing protein contains Pfam profiles PF00919: UPF0004 family protein, PF04055: radical SAM domain protein, PF01938: TRAM domain Length = 601 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 586 QIALIIRYSLFYVFDSQPTTSGASSSQTTLNR 681 +IA ++R+ Y F P SG+ S T +NR Sbjct: 299 EIAAVLRHPCVYTFLHVPVQSGSDSVLTAMNR 330 >At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 456 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 322 WLDECARSQLVFSCYRSLLESL 387 WLD+ ARS +V+ + S+LE+L Sbjct: 262 WLDKQARSSVVYISFGSMLETL 283 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,542,429 Number of Sequences: 28952 Number of extensions: 319228 Number of successful extensions: 684 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -