BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00584 (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 46 2e-06 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 25 3.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.3 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 45.6 bits (103), Expect = 2e-06 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = +2 Query: 101 LPEGWEARKSRSTGMTYYLNKHTKKSQWEKPGGPA 205 LP GWE R +++ G TYY+N +TK +QW +P PA Sbjct: 163 LPRGWEERSAQN-GRTYYVNHYTKTTQWSRPTEPA 196 Score = 30.3 bits (65), Expect = 0.065 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 101 LPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 193 LP GWE RK+ S G Y+++ + + +Q+ P Sbjct: 376 LPHGWEQRKTAS-GRVYFVDHNNRTTQFTDP 405 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 24.6 bits (51), Expect = 3.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 532 ANQFTLTLAFISFLELPKDCFHS*YYLKKCKTIISTY 642 A F L+L+ F L K C+ + K C++I+S Y Sbjct: 510 AKIFNLSLSLGVFPALWKSCWLFPVHKKGCRSIVSNY 546 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 389 EKLNLKSWQVHILIVHQQNVMGIWVVSRKVK 481 E+LN S Q+ I+ HQ N ++V R +K Sbjct: 1172 ERLNRASNQIAIVTTHQANTTAQFLVFRCMK 1202 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 716,143 Number of Sequences: 2352 Number of extensions: 12792 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -