BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00584 (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 24 1.7 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 24 1.7 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 24 1.7 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 6.9 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 362 KSIAVKSLTEKLNLKSWQVHILIVHQQNVMGI 457 K+ +K+ +LN K + HI++ +NV G+ Sbjct: 482 KNTMIKARQYRLNHKPFTYHIVVNSDKNVKGM 513 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 362 KSIAVKSLTEKLNLKSWQVHILIVHQQNVMGI 457 K+ +K+ +LN K + HI++ +NV G+ Sbjct: 482 KNTMIKARQYRLNHKPFTYHIVVNSDKNVKGM 513 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 362 KSIAVKSLTEKLNLKSWQVHILIVHQQNVMGI 457 K+ +K+ +LN K + HI++ +NV G+ Sbjct: 108 KNTMIKARQYRLNHKPFTYHIVVNSDKNVKGM 139 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +2 Query: 17 LLQLRKRKNLLAFPAQRTNDMASTQEEIL 103 L+ + ++++L QR ND T+EE++ Sbjct: 42 LVVKQTKQSVLEEARQRANDAGLTEEEVV 70 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,264 Number of Sequences: 438 Number of extensions: 4392 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -