BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00579 (730 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55260.1 68416.m06137 glycosyl hydrolase family 20 protein si... 33 0.19 At1g05590.1 68414.m00579 glycosyl hydrolase family 20 protein si... 31 0.59 At1g63780.1 68414.m07218 brix domain-containing protein contains... 28 5.5 At5g57420.1 68418.m07173 auxin-responsive factor-related contain... 28 7.3 At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (AT... 28 7.3 At4g30720.1 68417.m04354 expressed protein hypothetical protein ... 27 9.6 At4g03916.1 68417.m00552 hypothetical protein low similarity to ... 27 9.6 At1g10560.1 68414.m01189 armadillo/beta-catenin repeat family pr... 27 9.6 >At3g55260.1 68416.m06137 glycosyl hydrolase family 20 protein similar to beta-hexosaminidase A SP:P13723 from [Dictyostelium discoideum] Length = 541 Score = 33.1 bits (72), Expect = 0.19 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 538 ATIRGNSFFGVRHGLETLSQLIVYDDIRNNLLIVR 642 ATI N+ +G GLET SQL +D I ++ I + Sbjct: 140 ATIEANTVYGALRGLETFSQLCAFDYITKSVQIYK 174 >At1g05590.1 68414.m00579 glycosyl hydrolase family 20 protein similar to beta-hexosaminidase precursor SP:P43077 from [Candida albicans] Length = 580 Score = 31.5 bits (68), Expect = 0.59 Identities = 10/19 (52%), Positives = 17/19 (89%) Frame = +3 Query: 666 VYPYRGILLDTARNFYSID 722 ++ +RG+LLDT+RN+Y +D Sbjct: 170 LFGHRGVLLDTSRNYYGVD 188 >At1g63780.1 68414.m07218 brix domain-containing protein contains Pfam domain, PF04427: Brix domain Length = 294 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 339 TTSSQRLPTGLRHWFPVPCLKASRRRLQENQSQFI 443 T QR+ L+H FP P L A R NQS +I Sbjct: 196 TQMGQRVGNILKHIFPAPKLDAKRIVTFSNQSDYI 230 >At5g57420.1 68418.m07173 auxin-responsive factor-related contains weak similarity to Swiss-Prot:P33078 auxin-responsive protein IAA5 (Indoleacetic acid-induced protein 5) (Auxin-induced protein AUX2-27) [Arabidopsis thaliana] Length = 171 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 598 LIVYDDIRNNLLIVRDVTIKD 660 LI Y+D+ N+LL+ D+T KD Sbjct: 127 LIAYEDMENDLLLAGDLTWKD 147 >At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (ATHIM) identical to SP|P34881 DNA (cytosine-5)-methyltransferase AthI (EC 2.1.1.37) {Arabidopsis thaliana} Length = 1534 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = -3 Query: 275 YPDLSRSWFRPE---ETIIVTEHLAGFQTEDRLLILRLVP 165 Y +++ SWF+ E TI +T+H+ E L+ +L+P Sbjct: 1359 YKEVAVSWFQKEIRGNTIALTDHICKAMNELNLIRCKLIP 1398 >At4g30720.1 68417.m04354 expressed protein hypothetical protein - Synechocystis sp. (strain PCC 6803),PIR2:S76076 Length = 749 Score = 27.5 bits (58), Expect = 9.6 Identities = 22/78 (28%), Positives = 30/78 (38%) Frame = -2 Query: 435 VTDFPAAFAEKPLGTELETSVLNLSAAAVRRSSLFPCLVI*MSMVFILILERKLPRFVSI 256 VTDF K T L S L + LFP + I + E++LP F+S Sbjct: 608 VTDF---LQNKLSETPLPPSSYRLGVKSANLHELFPAHITEALRESISMFEKELPGFISE 664 Query: 255 VVSARGDHNRHRTSCRLP 202 G R + R+P Sbjct: 665 EALLHGVETRTSSPVRIP 682 >At4g03916.1 68417.m00552 hypothetical protein low similarity to SP|P07271 DNA repair and recombination protein PIF1, mitochondrial precursor {Saccharomyces cerevisiae} Length = 251 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/53 (24%), Positives = 28/53 (52%) Frame = -3 Query: 659 SLIVTSRTINRLFLMSSYTIS*ESVSRP*RTPKKEFPRMVAFTLSLDVDESRA 501 ++I+T I L+S I+ P +K+FP +VAF ++++ + ++ Sbjct: 162 AVIITGGRIGDKVLISKILITPSDTKLPFNMRRKQFPIVVAFAMTINKSQGQS 214 >At1g10560.1 68414.m01189 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 697 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +2 Query: 317 ITKQGKSDDLLTAAADRFKTLVSSSVPKGFSAKAAGKSVTVYLVND 454 I K K++ ++ A R + VP+ +AK AGK + +L ++ Sbjct: 351 IRKHCKTNGIVLAGISRRRKSHDDVVPESLAAKGAGKLIAKFLTSE 396 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,234,522 Number of Sequences: 28952 Number of extensions: 350043 Number of successful extensions: 1033 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1033 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -