BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00578 (772 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 31 0.78 SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) 31 1.0 SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) 30 2.4 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_21963| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_45509| Best HMM Match : PX (HMM E-Value=0.063) 28 7.3 SB_51030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 31.5 bits (68), Expect = 0.78 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +2 Query: 128 KHVIVVSRLQQREIDRTSESIRKEEKNKHK-IDGL 229 K +V ++ Q RE DRT S++KE K+K IDGL Sbjct: 1125 KESLVTAQNQLRERDRTINSLKKEVKDKQSIIDGL 1159 >SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) Length = 428 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +3 Query: 294 SLHVLSTVRRPHLRLSRGHTDRWSIGIRTEA 386 SL T + P+L+LS+G +W +GIR+++ Sbjct: 253 SLPTTPTKKYPYLKLSQGKRPKWHLGIRSQS 283 >SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) Length = 591 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = +3 Query: 549 YGDAASMTMNLTGFNKMLEELDLHKLIDGGQTTDSTAYFHVQTTKMKKLSAALTVQNWLH 728 + D A + + G K+L+ +D+HK Q + H+Q KK S + LH Sbjct: 72 FPDIADLQFDTRGIAKLLKSVDVHKASGPDQIPCNNILLHIQHGFRKKYSCETQLITVLH 131 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 418 EEKRRLDSRNRYHQKLQKIRQKDRLKRDAK 507 EEKRR + R HQ+LQ I ++ R+A+ Sbjct: 237 EEKRRREELERLHQELQNILLAEKEAREAE 266 >SB_21963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 28.7 bits (61), Expect = 5.5 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 270 QNVTSFGDSLHVLSTVRRPHLRLSRGHTDRWSIGIRTEARDHGPHVPRIRREKEAGFE 443 +NVT F HV+ +R R H + GI+ DH PH P ++ A E Sbjct: 346 ENVTGFDSQFHVIPPLRGQLDRAGLRHA-LVTDGIQAICSDHQPHDPAAKQAPFAATE 402 >SB_45509| Best HMM Match : PX (HMM E-Value=0.063) Length = 556 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +2 Query: 131 HVIVVSRLQQREIDRTSESIRKEEKNKHKID 223 HV+ + + R DR S++ +KE+K+K+KI+ Sbjct: 368 HVLKFFQEKPRSRDRKSKNSKKEDKSKNKIE 398 >SB_51030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 361 Score = 27.9 bits (59), Expect = 9.6 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 420 REKEAGFEKPLPSEAPEDQTEGSLEEGREDV 512 RE + EK LPS E +G+ EE RE+V Sbjct: 280 RELDKKIEKLLPSSKCEGNEKGNAEERREEV 310 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,579,924 Number of Sequences: 59808 Number of extensions: 449096 Number of successful extensions: 1478 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1476 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -