BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00577 (765 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7M4I1 Cluster: Putative uncharacterized protein; n=1; ... 36 1.1 UniRef50_Q6HMM0 Cluster: Putative uncharacterized protein; n=1; ... 34 4.4 UniRef50_Q8SSE5 Cluster: DNA REPLICATION LICENSING FACTOR OF THE... 33 7.8 >UniRef50_A7M4I1 Cluster: Putative uncharacterized protein; n=1; Bacteroides ovatus ATCC 8483|Rep: Putative uncharacterized protein - Bacteroides ovatus ATCC 8483 Length = 623 Score = 35.9 bits (79), Expect = 1.1 Identities = 30/93 (32%), Positives = 47/93 (50%) Frame = -1 Query: 765 YIIITYILKYTFLGDPRFSLIWTGSIFFSIVIVLTSTNFLGFFFFEM*VIC*SESFLKTF 586 Y ++ YI+ Y G+ SL+ S F + VL++ F F+ F + V S L F Sbjct: 43 YFLLRYIITYDKKGEQ--SLL---SSFTVCIAVLSALAFYSFYLFCVSVHEMGFSSLYDF 97 Query: 585 GILQ*NLKVCNVLWTSIKFYFGTNETAIFIKSK 487 L L V N W+S+++ FG TA++I S+ Sbjct: 98 RFLYKPLGVPNNEWSSLQWLFGGIITAVYIYSE 130 >UniRef50_Q6HMM0 Cluster: Putative uncharacterized protein; n=1; Bacillus thuringiensis serovar konkukian|Rep: Putative uncharacterized protein - Bacillus thuringiensis subsp. konkukian Length = 78 Score = 33.9 bits (74), Expect = 4.4 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = -3 Query: 292 EIRLCIYLPSFIFNLFSAPGFYDIAKGSTQ*SST 191 EI+L IY +F+ FSAPGF+D +G + ST Sbjct: 44 EIKLKIYEKIDVFDNFSAPGFFDFIEGVNEIKST 77 >UniRef50_Q8SSE5 Cluster: DNA REPLICATION LICENSING FACTOR OF THE MCM FAMILY; n=1; Encephalitozoon cuniculi|Rep: DNA REPLICATION LICENSING FACTOR OF THE MCM FAMILY - Encephalitozoon cuniculi Length = 708 Score = 33.1 bits (72), Expect = 7.8 Identities = 20/44 (45%), Positives = 29/44 (65%) Frame = -1 Query: 219 RKVLRSNRQPGDDSAILIYGILGLLKSTLLSFHYQEKEQGVFFS 88 RK L S+R GD + IL+ G G+ KS LLSF ++ E+G++ S Sbjct: 348 RKELGSSRLRGDIN-ILLAGDPGISKSQLLSFIHRTSERGMYTS 390 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 640,042,302 Number of Sequences: 1657284 Number of extensions: 11520728 Number of successful extensions: 22475 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22470 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 63792713725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -