BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00577 (765 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0475 + 9724676-9724936,9725518-9726216,9726273-9726596,972... 29 4.1 >09_02_0475 + 9724676-9724936,9725518-9726216,9726273-9726596, 9726900-9727847 Length = 743 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -1 Query: 216 KVLRSNRQPGDDSAILIYGILGLLKSTLLSFHYQEKEQG 100 K L S P D S + I G+ GL K++L +++KE+G Sbjct: 130 KDLLSQSNPDDLSILPIVGLPGLGKTSLARLVFEDKEEG 168 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,145,649 Number of Sequences: 37544 Number of extensions: 276366 Number of successful extensions: 463 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -