BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00577 (765 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01150.1 68418.m00019 hypothetical protein contains Pfam prof... 28 5.9 >At5g01150.1 68418.m00019 hypothetical protein contains Pfam profile PF05056: Protein of unknown function (DUF674) Length = 501 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -2 Query: 365 ICRTYLPINE*AHKGIRTL*I*IYRNTIMYLPTFIYFQP--FFCPRFLRYRERFYAVIVN 192 +CRT+ +NE T + + N M LP I QP ++ R YR+ Y + N Sbjct: 317 MCRTFRDLNEETQMSTSTCALPSFYNFQMQLPGIITQQPPVYYRYRLYDYRQMNYGLTTN 376 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,826,373 Number of Sequences: 28952 Number of extensions: 252588 Number of successful extensions: 469 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -