BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00576 (620 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11717| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-19 SB_57383| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 30 1.7 SB_3946| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_15424| Best HMM Match : PAN (HMM E-Value=0.00016) 27 9.3 >SB_11717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 61.3 bits (142), Expect(3) = 2e-19 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +2 Query: 65 MRLPQSVSDDVDEDPTGNKALWDRGLLNGASQKGDV 172 +RLP SDDVDEDPTG KA WDRGLLNGA QK ++ Sbjct: 56 VRLPSGSSDDVDEDPTGTKAFWDRGLLNGAQQKREM 91 Score = 41.9 bits (94), Expect(3) = 2e-19 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = +2 Query: 167 DVVVNFHVGETVTSLQRATLIPGGSEA 247 + + N+ VGETV SLQ+ATLIPGGSE+ Sbjct: 127 ETMCNYFVGETVLSLQKATLIPGGSES 153 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +1 Query: 244 STTIATISGSLGVLLPFTSRE 306 S T+SG +G+L+PFTSRE Sbjct: 153 SLVFTTLSGGVGMLVPFTSRE 173 Score = 29.9 bits (64), Expect(3) = 2e-19 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +2 Query: 14 LDYDTIAVSDKFGNV 58 LDYDT+A +DKFGN+ Sbjct: 9 LDYDTLAGADKFGNI 23 >SB_57383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 52.0 bits (119), Expect = 4e-07 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 412 NVIDGDLCEQFNSLDPGKQKAIAGDLERTPAEDQKNLK 525 +V+DGDLCE +NSLD K++ IA +L+RTPAE K L+ Sbjct: 1 SVVDGDLCEHYNSLDYSKRRTIAEELDRTPAEVSKKLE 38 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 510 SKKLEDIRTRYA 545 SKKLEDIRTRYA Sbjct: 34 SKKLEDIRTRYA 45 >SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 1799 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 436 EQFNSLDPGKQKAIAGDLERTPAEDQKNLKTFELDMRS 549 E F +L+PGK+K G+ RT Q+ FE +M S Sbjct: 162 ETFEALEPGKKKDGQGERSRTEETVQEKALLFEQNMSS 199 >SB_3946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 436 EQFNSLDPGKQKAIAGDLERTPAEDQKNLKTFELDMRS 549 E F +L+PGK+K G+ RT Q+ FE +M S Sbjct: 200 ETFEALEPGKKKDGQGERSRTEETVQEKALLFEQNMSS 237 >SB_15424| Best HMM Match : PAN (HMM E-Value=0.00016) Length = 702 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -3 Query: 192 PT*KLTTTSPFCEAPLSKPLSQSALF 115 PT + +PF APLS+P SQS F Sbjct: 346 PTFRAPHQTPFFRAPLSEPHSQSPTF 371 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,010,139 Number of Sequences: 59808 Number of extensions: 362297 Number of successful extensions: 850 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -