Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00574
         (732 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q036N2 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  

>UniRef50_Q036N2 Cluster: Putative uncharacterized protein; n=1;
           Lactobacillus casei ATCC 334|Rep: Putative
           uncharacterized protein - Lactobacillus casei (strain
           ATCC 334)
          Length = 268

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 2/67 (2%)
 Frame = +3

Query: 48  FW*LRRREDLPPAGEIAHLINDPMLL--FGTIIYDSLSLKYCKRNSGTIKYLVLYNRYHH 221
           FW +   E L  A    +LIN  ++L  FG  +Y +   KY    +  + +   + R H 
Sbjct: 76  FWVIGSLEKLMTAWNFGNLINALIVLWLFGYFLYQTWQTKYLNEQNRYLTFANHFQRQHF 135

Query: 222 SILLAVF 242
           + ++A+F
Sbjct: 136 NAVMAIF 142


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 621,125,615
Number of Sequences: 1657284
Number of extensions: 11080107
Number of successful extensions: 31456
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 26913
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30956
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 59265488880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)