BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00574 (732 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q036N2 Cluster: Putative uncharacterized protein; n=1; ... 33 7.2 >UniRef50_Q036N2 Cluster: Putative uncharacterized protein; n=1; Lactobacillus casei ATCC 334|Rep: Putative uncharacterized protein - Lactobacillus casei (strain ATCC 334) Length = 268 Score = 33.1 bits (72), Expect = 7.2 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Frame = +3 Query: 48 FW*LRRREDLPPAGEIAHLINDPMLL--FGTIIYDSLSLKYCKRNSGTIKYLVLYNRYHH 221 FW + E L A +LIN ++L FG +Y + KY + + + + R H Sbjct: 76 FWVIGSLEKLMTAWNFGNLINALIVLWLFGYFLYQTWQTKYLNEQNRYLTFANHFQRQHF 135 Query: 222 SILLAVF 242 + ++A+F Sbjct: 136 NAVMAIF 142 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 621,125,615 Number of Sequences: 1657284 Number of extensions: 11080107 Number of successful extensions: 31456 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 26913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30956 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 59265488880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -