BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00573 (627 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_20267| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35263| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_56223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_23116| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_20262| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_39408| Best HMM Match : Cadherin (HMM E-Value=0) 29 3.1 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_2467| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_57501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_55933| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_12106| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_38776| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0013) 28 5.4 SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.4 SB_19815| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0013) 28 5.4 SB_49457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_45168| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_32196| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 27 9.4 SB_11711| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-10) 27 9.4 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +1 Query: 163 SDNDKSSDYNFDGSLKNINKKGNNDNFDEDEKKLSK 270 ++N+ ++D FD S++N N GN N ++DEK SK Sbjct: 376 TENNSNND-GFDNSIRNDNNAGNKSN-NKDEKNNSK 409 >SB_20267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 30.7 bits (66), Expect = 1.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 166 DNDKSSDYNFDGSLKNINKKGNNDNFDEDE 255 +ND + +YN +G+ N + NNDN+D ++ Sbjct: 272 NNDNNDNYNNNGNNDNNDNYDNNDNYDNND 301 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 145 YNF*MASDNDKSSDYNFDGSLKNINK--KGNNDNFDEDE 255 YN+ +ND ++ N D + N N GNNDN+D ++ Sbjct: 212 YNYDNNDNNDNDNNDNNDKNDNNDNNDNNGNNDNYDNND 250 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 148 NF*MASDNDKSSDYNFDGSLKNINKKGNNDNFDEDE 255 N+ +ND + +Y+ +G+ N + NNDN+D ++ Sbjct: 332 NYDNNDNNDNNDNYDNNGNNDNNDNYDNNDNYDNND 367 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 163 SDNDKSSDYNFDGSLKNINKKGNNDNFDED 252 +DND + +Y+ + + N + NNDN+D + Sbjct: 173 NDNDNNDNYDDNDNNDNNDNYDNNDNYDNN 202 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 340 RSPFVIVESKGIDKCRPPFPTGAVLKAFSHLHQ 242 +S F I + KG DKC+PP T + K +H Q Sbjct: 349 KSYFKIQDPKGTDKCKPPKITLELPKELNHAQQ 381 >SB_35263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 163 SDNDKSSDYNFDGSLKNINKKGNNDNFDEDEKKLS 267 SDN+ +SD N NI+ N+DN + D +S Sbjct: 182 SDNNNTSDNNNTSDNNNISDNNNSDNNNSDNNNIS 216 >SB_56223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1719 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 166 DNDKSSDYNFDGSLKNINKKGNNDNFDEDEK 258 D+D DYN DG ++ +K +D E+E+ Sbjct: 266 DDDNGDDYNDDGEMEGQDKDSGDDYIPEEEE 296 >SB_23116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 163 SDNDKSSDYNFDGSLKNINKKGNNDNFDEDE 255 S N +++YN D + N K NN+N D+D+ Sbjct: 105 SSNYDNNNYNNDNDNNDNNNKNNNNNNDDDD 135 >SB_20262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 166 DNDKSSDYNFDGSLKNINKKGNNDNFDEDE 255 DND +D N D + N N GNNDN D ++ Sbjct: 34 DNDNDNDNNNDNNDSNDNN-GNNDNNDNND 62 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 148 NF*MASDNDKS-SDYNFDGSLKNINKKGNNDNFDEDE 255 N+ DND + ++YN+D N + GNNDN+D ++ Sbjct: 147 NYDNYDDNDNNDNNYNYD----NNDNNGNNDNYDNND 179 >SB_39408| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2389 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = +1 Query: 142 RYNF*MASDNDKSSDYNFDGSLKNINKKGNNDNFDEDEKKLSKR 273 RYN + N+K+++ N+ G +N N N+N D+KKL +R Sbjct: 455 RYN---RNSNNKNNNINYKGQKRNDNNSFGNNN---DKKKLKQR 492 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 163 SDNDKSSDYNFDGSLKNINKKGNNDNFDEDEKKLSK 270 +DND +D + D N N N+++ D D KL K Sbjct: 3252 NDNDNDNDNDNDNDNDNDNDNDNDNDNDNDSYKLKK 3287 >SB_2467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = +1 Query: 163 SDNDKSSDYNFDGSLKNINKKGNNDNFDEDEKKLSKRHLLEKAVDIYQYLLTRL 324 +DND +D + D N N NN+N + D S L+ + ++ + + ++ Sbjct: 89 NDNDNDNDNDNDNDNDNDNDNDNNNNNNNDNNNNSIDDALKILIIMFSFFIVQI 142 >SB_57501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 166 DNDKSSDYNFDGSLKNINKKGNNDNFDEDEKKLSKRH 276 D+D D + D + + N GN+D+ D+D+ LS H Sbjct: 103 DDDSDDDDDNDSNDDDDNGDGNDDDDDDDDTVLSPYH 139 >SB_55933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 489 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 166 DND-KSSDYNFDGSLKNINKKGNNDNFDED 252 DND + DY DG + + GN+D++++D Sbjct: 432 DNDGNNDDYKIDGDDDDYDNDGNDDDYNDD 461 >SB_12106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 163 SDNDKSSDYNFDGSLKNINKKGNNDNFDED 252 +DND + + D + KN N K NND+ +E+ Sbjct: 88 NDNDTNDENINDDNEKNTNDKNNNDDSNEN 117 Score = 28.3 bits (60), Expect = 5.4 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 6/43 (13%) Frame = +1 Query: 166 DNDKSSDYNFDGSLKNINK-KGNNDNFDED-----EKKLSKRH 276 DNDK++ N D KN +K K ND+FD++ +KK +RH Sbjct: 121 DNDKNT--NDDNDKKNDDKDKNTNDDFDDNTTDDIDKKHQRRH 161 >SB_38776| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0013) Length = 122 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 440 RKTVQTVEMETEKEIRKIRSSF*TLERKIS 529 RK +Q V E+E+EI ++S LER+++ Sbjct: 73 RKKLQAVRSESEREITNLKSKVAQLERRLA 102 >SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 4303 Score = 28.3 bits (60), Expect = 5.4 Identities = 25/90 (27%), Positives = 42/90 (46%) Frame = -3 Query: 433 ENLDLVRSAGGVLAPDPRLFVRTAEPFCFFARSPFVIVESKGIDKCRPPFPTGAVLKAFS 254 E+L +++SA + P+P + RTA SP +E K +KC + + + +K Sbjct: 3695 EDLPVLQSAV-IRPPEPEI-QRTAPV------SPQTPIEYK-CNKCSNSYVSFSEMK--K 3743 Query: 253 HLHQSYHCFPSY*CSSMNHQSCNPNFYHCH 164 H+ +HC PS C + C P + H Sbjct: 3744 HMSTVHHCRPSKTCELCSKMFCRPEYVAKH 3773 Score = 27.9 bits (59), Expect = 7.1 Identities = 25/90 (27%), Positives = 42/90 (46%) Frame = -3 Query: 433 ENLDLVRSAGGVLAPDPRLFVRTAEPFCFFARSPFVIVESKGIDKCRPPFPTGAVLKAFS 254 E+L +++SA + P+P + RTA SP +E K +KCR + + + +K Sbjct: 3275 EDLPVLQSAV-IRTPEPEI-QRTAPV------SPQTPIEYK-CNKCRNSYVSFSEMK--K 3323 Query: 253 HLHQSYHCFPSY*CSSMNHQSCNPNFYHCH 164 H+ ++C PS C C P + H Sbjct: 3324 HMSTVHNCRPSKTCELCGKMFCTPEYVAKH 3353 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -3 Query: 340 RSPFVIVESKGIDKCRPPFPTGAVLKAFSHLHQSYHCFPSY*CSSMNHQSCNPNFYHCH 164 RSP +E K +KC + + + +K H+ ++C PS C + C P + H Sbjct: 2588 RSPQTPIEYK-CNKCSNSYVSFSEMK--KHMRTVHNCRPSKTCELCSKMFCRPEYVAKH 2643 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -3 Query: 340 RSPFVIVESKGIDKCRPPFPTGAVLKAFSHLHQSYHCFPSY*CSSMNHQSCNPNFYHCH 164 RSP +E K +KC + + + +K H+ ++C PS C + C P + H Sbjct: 2786 RSPQTPIEYK-CNKCSNSYVSFSEMK--KHMRTVHNCRPSKTCELCGKKFCTPEYVAKH 2841 >SB_19815| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0013) Length = 122 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 440 RKTVQTVEMETEKEIRKIRSSF*TLERKIS 529 RK +Q V E+E+EI ++S LER+++ Sbjct: 73 RKKLQAVRSESEREITNLKSKVAQLERRLA 102 >SB_49457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 941 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Frame = +1 Query: 169 NDKSSDYNFDGSLKNINK---KGNNDNFDEDEKKLSK 270 ND+SS DG+L N + +G+N++ DE++ + SK Sbjct: 763 NDESSHVVVDGALMNNGRNTDEGSNESNDEEQSEASK 799 >SB_45168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -1 Query: 414 VPRAASSHQTQGYSFAPPNHSVSLPDRHSS*SSQKVLI 301 +PR ++ H T GY P+ + + PD H++ S+ K +I Sbjct: 344 IPRHSNPHYTHGYVPIFPDSNGNPPDDHTNNSTPKDVI 381 >SB_32196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1333 Score = 27.9 bits (59), Expect = 7.1 Identities = 9/31 (29%), Positives = 21/31 (67%) Frame = +1 Query: 163 SDNDKSSDYNFDGSLKNINKKGNNDNFDEDE 255 ++N+ +++ N + + N N NND++D+D+ Sbjct: 273 NNNNNNNNNNNNNNNNNNNNNNNNDDYDDDD 303 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 437 LRKTVQTVEMETEKEIRKIRSSF*TLERKISVRANRDELVQK 562 L KTV+ EKEI+K+RS L+R+ S + + ++K Sbjct: 1228 LLKTVKNENEIQEKEIKKLRSEVLELQREASGAQGKCDTLEK 1269 >SB_11711| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-10) Length = 948 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 184 DYNFDGSLKNINKKGNNDN 240 DY+FDG+ N N NN+N Sbjct: 17 DYDFDGNNNNNNNSNNNNN 35 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 163 SDNDKSSDYNFDGSLKNINKKGNNDNFDEDEKKLSKRH 276 +D K D++ D N + G +DN D+D +RH Sbjct: 2058 NDEYKGPDFHDDALSSNDDVVGYHDNIDDDPSDSHRRH 2095 >SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 163 SDNDKSSDYNFDGSLKNINKKGNNDN 240 ++ND +SD N + + N N NNDN Sbjct: 596 NNNDNNSDNNNNNNNNNNNNNNNNDN 621 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,005,068 Number of Sequences: 59808 Number of extensions: 292035 Number of successful extensions: 1580 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1515 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -