BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00570 (740 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22A12.05 |rpc11||DNA-directed RNA polymerase III complex sub... 26 6.5 SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces ... 26 6.5 SPCC613.11c |meu23|B13958-2|DUF1773 family protein 2|Schizosacch... 26 6.5 >SPAC22A12.05 |rpc11||DNA-directed RNA polymerase III complex subunit Rpc11|Schizosaccharomyces pombe|chr 1|||Manual Length = 109 Score = 25.8 bits (54), Expect = 6.5 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = -3 Query: 543 FDASREVIVQCNKCKCKSNISFFF 472 F+++++ V C KC +N ++FF Sbjct: 59 FESNQQTEVTCENTKCDNNRAYFF 82 >SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1429 Score = 25.8 bits (54), Expect = 6.5 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 390 IISCTYKFGFTKDMKRFLLNIKVSNLS*D*NCFYGLMSSF 271 +IS KFGF K M F + IK LS +GL S + Sbjct: 367 LISLVIKFGFGKYMFSFPITIKDLRLSGKLRIRWGLSSDY 406 >SPCC613.11c |meu23|B13958-2|DUF1773 family protein 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 254 Score = 25.8 bits (54), Expect = 6.5 Identities = 14/58 (24%), Positives = 28/58 (48%) Frame = +3 Query: 540 QSTINVMASSVSIYRFVKKTNYENL*NYTNFEKGKKIPTKIHKNNNMLHESVSLCPLP 713 Q TIN M +++ + T EN+ N+TN + + +N ++ + + P+P Sbjct: 125 QRTINTMQGTMNTMQGTMNTMQENMINFTNKVNTLDMRSVRAENRDLRKGAYVISPVP 182 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,821,963 Number of Sequences: 5004 Number of extensions: 56399 Number of successful extensions: 119 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -