BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00569 (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18100.1 68414.m02244 mother of FT and TF1 protein (MFT) iden... 55 5e-08 At5g62040.1 68418.m07787 brother of FT and TFL1 protein (BFT) id... 48 5e-06 At2g27550.1 68415.m03338 centroradialis protein, putative (CEN) ... 44 1e-04 At1g65480.1 68414.m07429 flowering locus T protein (FT) identica... 43 2e-04 At5g03840.1 68418.m00354 terminal flower 1 protein (TFL1) identi... 42 5e-04 At4g20370.1 68417.m02973 twin sister of FT protein (TSF) / TFL1 ... 42 5e-04 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 31 0.88 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 31 0.88 At5g17920.1 68418.m02101 5-methyltetrahydropteroyltriglutamate--... 29 2.7 At4g35985.1 68417.m05121 senescence/dehydration-associated prote... 29 3.5 At2g29125.1 68415.m03540 expressed protein 28 4.7 At1g11950.1 68414.m01381 transcription factor jumonji (jmjC) dom... 28 4.7 At1g08270.1 68414.m00913 expressed protein low similarity to SP|... 28 4.7 At4g25170.1 68417.m03624 expressed protein 27 8.2 At4g04470.1 68417.m00649 peroxisomal membrane protein 22 kDa (PM... 27 8.2 At3g42730.1 68416.m04462 Ulp1 protease family protein contains P... 27 8.2 At1g76510.2 68414.m08903 ARID/BRIGHT DNA-binding domain-containi... 27 8.2 At1g76510.1 68414.m08902 ARID/BRIGHT DNA-binding domain-containi... 27 8.2 At1g64920.1 68414.m07359 glycosyltransferase family protein cont... 27 8.2 >At1g18100.1 68414.m02244 mother of FT and TF1 protein (MFT) identical to SP|Q9XFK7 MOTHER of FT and TF1 protein {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 173 Score = 54.8 bits (126), Expect = 5e-08 Identities = 32/86 (37%), Positives = 44/86 (51%), Gaps = 1/86 (1%) Frame = +1 Query: 250 PCAPSRKEPTFREWHHWLVGNIQ-GNEVNSGETLSQYVGSGPPEKTGLHRYVFLLYKQPS 426 P APS EP REW HW+V +I G + G+ + Y+ PP G+HRY+ +L++Q S Sbjct: 70 PDAPSPSEPNMREWVHWIVVDIPGGTNPSRGKEILPYMEPRPP--VGIHRYILVLFRQNS 127 Query: 427 KLTFDEPRLTNTSSDKRANFKIAEFA 504 + L RANF FA Sbjct: 128 PV-----GLMVQQPPSRANFSTRMFA 148 Score = 31.5 bits (68), Expect = 0.50 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 77 QVVPDVIPK-APAALLQVKYPSGVEVKEGNELTPTLVKDEPSVKWDAEPGQYYTLAMTDP 253 +V+ DV+ P A + V Y + G E+ P+ + P V + YTL MTDP Sbjct: 12 RVIGDVLDMFIPTANMSV-YFGPKHITNGCEIKPSTAVNPPKVNISGHSDELYTLVMTDP 70 >At5g62040.1 68418.m07787 brother of FT and TFL1 protein (BFT) identical to SP|Q9FIT4 BROTHER of FT and TFL1 protein {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 177 Score = 48.0 bits (109), Expect = 5e-06 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +1 Query: 250 PCAPSRKEPTFREWHHWLVGNIQG-NEVNSGETLSQYVGSGPPEKTGLHRYVFLLYKQ 420 P APS P RE+ HW+V +I G + + G + +Y P G+HRYVF L+KQ Sbjct: 72 PDAPSPSNPYMREYLHWMVTDIPGTTDASFGREIVRY--ETPKPVAGIHRYVFALFKQ 127 Score = 38.3 bits (85), Expect = 0.004 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 2/92 (2%) Frame = +2 Query: 44 MSTVAKSFEASQVVPDVIPKA-PAALLQVKYPSGVEVKEGNELTPTLVKDEPSVKWDAEP 220 MS + +V+ DV+ P+ ++V + S V G+EL P+L+ +P V+ + Sbjct: 1 MSREIEPLIVGRVIGDVLEMFNPSVTMRVTFNSNTIVSNGHELAPSLLLSKPRVEIGGQD 60 Query: 221 -GQYYTLAMTDPVRRPVKNPHFANGTTGWLAT 313 ++TL M DP NP+ W+ T Sbjct: 61 LRSFFTLIMMDPDAPSPSNPYMRE-YLHWMVT 91 >At2g27550.1 68415.m03338 centroradialis protein, putative (CEN) strong similarity to SP|Q41261 CENTRORADIALIS protein {Antirrhinum majus}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 175 Score = 43.6 bits (98), Expect = 1e-04 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +1 Query: 250 PCAPSRKEPTFREWHHWLVGNIQGN-EVNSGETLSQYVGSGPPEKTGLHRYVFLLYKQ 420 P P +P RE HW+V +I G +V+ G+ + Y P G+HR+V+LL+KQ Sbjct: 73 PDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKEIIGY--EMPRPNIGIHRFVYLLFKQ 128 >At1g65480.1 68414.m07429 flowering locus T protein (FT) identical to SP|Q9SXZ2 FLOWERING LOCUS T protein {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 175 Score = 43.2 bits (97), Expect = 2e-04 Identities = 31/97 (31%), Positives = 42/97 (43%), Gaps = 1/97 (1%) Frame = +1 Query: 250 PCAPSRKEPTFREWHHWLVGNIQGNE-VNSGETLSQYVGSGPPEKTGLHRYVFLLYKQPS 426 P PS P RE+ HWLV +I G + Y P G+HR VF+L++Q Sbjct: 72 PDVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVCY--ENPSPTAGIHRVVFILFRQLG 129 Query: 427 KLTFDEPRLTNTSSDKRANFKIAEFAKSTT*GIRLRA 537 + T P R NF EFA+ G+ + A Sbjct: 130 RQTVYAP-------GWRQNFNTREFAEIYNLGLPVAA 159 Score = 39.5 bits (88), Expect = 0.002 Identities = 30/82 (36%), Positives = 41/82 (50%), Gaps = 2/82 (2%) Frame = +2 Query: 74 SQVVPDVI-PKAPAALLQVKYPSGVEVKEGNELTPTLVKDEPSVKWDAEP-GQYYTLAMT 247 S+VV DV+ P + L+V Y EV G +L P+ V+++P V+ E +YTL M Sbjct: 12 SRVVGDVLDPFNRSITLKVTYGQR-EVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMV 70 Query: 248 DPVRRPVKNPHFANGTTGWLAT 313 DP NPH WL T Sbjct: 71 DPDVPSPSNPHLRE-YLHWLVT 91 >At5g03840.1 68418.m00354 terminal flower 1 protein (TFL1) identical go SP|P93003 TERMINAL FLOWER 1 protein {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 177 Score = 41.5 bits (93), Expect = 5e-04 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +1 Query: 250 PCAPSRKEPTFREWHHWLVGNIQGN-EVNSGETLSQYVGSGPPEKTGLHRYVFLLYKQPS 426 P P +P +E HW+V NI G + G+ + Y P G+HR+VF+L++Q Sbjct: 75 PDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSY--ELPRPSIGIHRFVFVLFRQKQ 132 Query: 427 K 429 + Sbjct: 133 R 133 >At4g20370.1 68417.m02973 twin sister of FT protein (TSF) / TFL1 like protein identical to SP|Q9S7R5 TWIN SISTER of FT protein (TFL1 like protein) {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 175 Score = 41.5 bits (93), Expect = 5e-04 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +1 Query: 250 PCAPSRKEPTFREWHHWLVGNIQGNEVNS-GETLSQYVGSGPPEKTGLHRYVFLLYKQPS 426 P PS P RE+ HWLV +I N+ G + Y PP +G+HR V +L++Q Sbjct: 72 PDVPSPSNPHQREYLHWLVTDIPATTGNAFGNEVVCYESPRPP--SGIHRIVLVLFRQLG 129 Query: 427 KLTFDEP 447 + T P Sbjct: 130 RQTVYAP 136 Score = 33.5 bits (73), Expect = 0.12 Identities = 28/80 (35%), Positives = 38/80 (47%), Gaps = 2/80 (2%) Frame = +2 Query: 80 VVPDVI-PKAPAALLQVKYPSGVEVKEGNELTPTLVKDEPSVKWDAEPGQ-YYTLAMTDP 253 VV DV+ P L+V Y EV G +L P+ V ++P V+ + + +YTL M DP Sbjct: 14 VVGDVLDPFTRLVSLKVTYGHR-EVTNGLDLRPSQVLNKPIVEIGGDDFRNFYTLVMVDP 72 Query: 254 VRRPVKNPHFANGTTGWLAT 313 NPH WL T Sbjct: 73 DVPSPSNPH-QREYLHWLVT 91 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 30.7 bits (66), Expect = 0.88 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 3/73 (4%) Frame = +2 Query: 347 CPSTWALDLRKRQACTDTCSSCTNNHRSSHSTS-RDSLTLRATN--VPISKLPSSPRVQP 517 C W +DL + + C ++ +N H S S RD + L N + KL S V P Sbjct: 290 CVGVWVVDLSRTEPCMAGDTAQSNGHPEKRSCSGRDPVVLNDNNSKTVLGKLSVSQNVDP 349 Query: 518 RGSDCGQLLRSAV 556 + L R +V Sbjct: 350 LLKETKSLGRLSV 362 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 30.7 bits (66), Expect = 0.88 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 3/73 (4%) Frame = +2 Query: 347 CPSTWALDLRKRQACTDTCSSCTNNHRSSHSTS-RDSLTLRATN--VPISKLPSSPRVQP 517 C W +DL + + C ++ +N H S S RD + L N + KL S V P Sbjct: 290 CVGVWVVDLSRTEPCMAGDTAQSNGHPEKRSCSGRDPVVLNDNNSKTVLGKLSVSQNVDP 349 Query: 518 RGSDCGQLLRSAV 556 + L R +V Sbjct: 350 LLKETKSLGRLSV 362 >At5g17920.1 68418.m02101 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase / vitamin-B12-independent methionine synthase / cobalamin-independent methionine synthase (CIMS) identical to SP|O50008 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (EC 2.1.1.14) (Vitamin-B12-independent methionine synthase isozyme) (Cobalamin-independent methionine synthase isozyme) {Arabidopsis thaliana} Length = 765 Score = 29.1 bits (62), Expect = 2.7 Identities = 20/73 (27%), Positives = 32/73 (43%) Frame = +2 Query: 29 VLTRAMSTVAKSFEASQVVPDVIPKAPAALLQVKYPSGVEVKEGNELTPTLVKDEPSVKW 208 +L++A V KSFE ++P ++P + ++K ++ P LV D K Sbjct: 163 LLSKAAKGVDKSFELLSLLPKILPIYKEVITELKAAGATWIQLDE---PVLVMDLEGQKL 219 Query: 209 DAEPGQYYTLAMT 247 A G Y L T Sbjct: 220 QAFTGAYAELEST 232 >At4g35985.1 68417.m05121 senescence/dehydration-associated protein-related similar to senescence-associated protein 12 [Hemerocallis hybrid cultivar] gi|3551958|gb|AAC34857; similar to early-responsive to dehydration stress ERD7 protein [Arabidopsis thaliana] gi|15320412|dbj|BAB63916 Length = 448 Score = 28.7 bits (61), Expect = 3.5 Identities = 20/60 (33%), Positives = 30/60 (50%) Frame = +2 Query: 116 LLQVKYPSGVEVKEGNELTPTLVKDEPSVKWDAEPGQYYTLAMTDPVRRPVKNPHFANGT 295 L+Q V + G+E+ L KDEP+VK D E +++L PV+ + H N T Sbjct: 101 LVQGDITVAVFARVGDEIQWPLTKDEPAVKVD-ESHYFFSLR---PVKESESSDHSVNET 156 >At2g29125.1 68415.m03540 expressed protein Length = 115 Score = 28.3 bits (60), Expect = 4.7 Identities = 18/61 (29%), Positives = 35/61 (57%) Frame = +1 Query: 427 KLTFDEPRLTNTSSDKRANFKIAEFAKSTT*GIRLRATSTKRSMTTTSLFCTSSSVLKYA 606 KL+ + +++SS + + + A ST I +R++STK S+ ++S +SSS + + Sbjct: 6 KLSKKDTTASSSSSKSKFSRSFSTSASSTKSPIFVRSSSTKCSVPSSSSSSSSSSSISRS 65 Query: 607 F 609 F Sbjct: 66 F 66 >At1g11950.1 68414.m01381 transcription factor jumonji (jmjC) domain-containing protein contains Pfam domain, PF02373: jmjC domain; non-consensus TG acceptor splice site at exon boundary 79262 Length = 880 Score = 28.3 bits (60), Expect = 4.7 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -2 Query: 391 AGLSFPEVQSPRTGT-KFRRSLPRCPGCCQPASGAIREMWVLYGTAHRVGHGQSV 230 + L F E PR+G LP G +P G + +V YGT+ +G G SV Sbjct: 604 SALPFQEYSDPRSGILNIATKLPE--GLLKPDLGP--KTYVAYGTSDELGRGDSV 654 >At1g08270.1 68414.m00913 expressed protein low similarity to SP|P46467 SKD1 protein (Vacuolar sorting protein 4b) {Mus musculus} Length = 126 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +2 Query: 140 GVEVKEGNELTPTLVKDEPSVKWDAEPG-QYYTLAMTDPVRRPVKNPHFANG 292 G E K L +++++P+VKW G + A+ + V PV P F G Sbjct: 70 GEESKLRAGLNSAIIREKPNVKWTVVAGLESAKQALKEAVILPVNFPQFFTG 121 >At4g25170.1 68417.m03624 expressed protein Length = 344 Score = 27.5 bits (58), Expect = 8.2 Identities = 21/58 (36%), Positives = 24/58 (41%), Gaps = 7/58 (12%) Frame = -1 Query: 428 FDGCLYK---RNTYLCRPVFSGG---PEPTYWDKVSPEFTS-LPWMLPTSQWCHSRNV 276 FD Y R+ Y C P GG P T P F S WM P+ CHSR + Sbjct: 139 FDASSYSQLVRDKYECYPENGGGNQSPIATGMVHQVPSFGSDSDWMEPSMHLCHSRTL 196 >At4g04470.1 68417.m00649 peroxisomal membrane protein 22 kDa (PMP22) identical to peroxisomal membrane protein [Arabidopsis thaliana] gi|3980254|emb|CAA06834 Length = 190 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 358 VGSGPPEKTGLHRYVFLLYKQP 423 +GS PP+KT L RY+ L + P Sbjct: 1 MGSSPPKKTTLQRYLSQLQQHP 22 >At3g42730.1 68416.m04462 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1314 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -2 Query: 361 PRTGTKFRRSLPRCPGCCQPASGAIREMWVLYGTAHRVGHG 239 P+ F L CCQ + + EMW+++G H + G Sbjct: 110 PKNKASFNAKLVLGLICCQLVTKKVNEMWIVFG-GHPIRFG 149 >At1g76510.2 68414.m08903 ARID/BRIGHT DNA-binding domain-containing protein contains Pfam profile PF01388: ARID/BRIGHT DNA binding domain Length = 434 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +1 Query: 169 DSNSGERRAFSEMGRGARTVLHSGHDR--PCAPSRKEPTFREWHHWLVGNIQGNEVN 333 D + E++ S+ G+ T+ S + P +P E + ++W WL+ + + EV+ Sbjct: 81 DVDQSEKKITSDGGQEETTLGESNPLKGDPSSPHVPEESVKKWKTWLLSDAEAREVD 137 >At1g76510.1 68414.m08902 ARID/BRIGHT DNA-binding domain-containing protein contains Pfam profile PF01388: ARID/BRIGHT DNA binding domain Length = 434 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +1 Query: 169 DSNSGERRAFSEMGRGARTVLHSGHDR--PCAPSRKEPTFREWHHWLVGNIQGNEVN 333 D + E++ S+ G+ T+ S + P +P E + ++W WL+ + + EV+ Sbjct: 81 DVDQSEKKITSDGGQEETTLGESNPLKGDPSSPHVPEESVKKWKTWLLSDAEAREVD 137 >At1g64920.1 68414.m07359 glycosyltransferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 452 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 220 RTVLHSGHDRPCAPSRKEPTFREWHHWLVGNIQGNEV 330 + VL +G P P + +P +W HWL G QG+ V Sbjct: 219 KKVLLTGPMLP-EPDKSKPLEDQWSHWLSGFGQGSVV 254 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,460,655 Number of Sequences: 28952 Number of extensions: 353897 Number of successful extensions: 1043 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -