Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00564
         (754 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    24   1.3  
Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein RJP...    23   3.1  
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    23   3.1  
AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    23   3.1  
D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.         22   5.4  
AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly pro...    22   5.4  
AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly pro...    22   5.4  
AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly pro...    22   5.4  
AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    22   7.1  
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    22   7.1  

>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 10/38 (26%), Positives = 20/38 (52%)
 Frame = +2

Query: 635 DSDIIIVFVDYYRMFYCLC*QIRVLVSANYFVFVIIRY 748
           D D+ +V +++     CL   I ++    Y  F+I++Y
Sbjct: 387 DDDVKLVLLNFGWQMICLIVVIALVSIIMYIAFIILQY 424


>Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein
           RJP57-2 protein.
          Length = 464

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = -2

Query: 183 CWNRHQAFER 154
           CWN HQ+ +R
Sbjct: 327 CWNEHQSLDR 336


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 183 CWNRHQAFERD 151
           CWN HQ  +R+
Sbjct: 330 CWNEHQPLQRE 340


>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = -2

Query: 183 CWNRHQAFER 154
           CWN HQ+ +R
Sbjct: 327 CWNEHQSLQR 336


>D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.
          Length = 432

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = -2

Query: 183 CWNRHQAFER 154
           CWN H+  ER
Sbjct: 329 CWNEHRTLER 338


>AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly
           protein MRJP6 protein.
          Length = 437

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = -2

Query: 183 CWNRHQAFER 154
           CWN HQ  +R
Sbjct: 330 CWNEHQPLQR 339


>AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = -2

Query: 183 CWNRHQAFER 154
           CWN H+  ER
Sbjct: 329 CWNEHRTLER 338


>AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = -2

Query: 183 CWNRHQAFER 154
           CWN H+  ER
Sbjct: 329 CWNEHRTLER 338


>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 9/26 (34%), Positives = 13/26 (50%)
 Frame = +3

Query: 141 LITDPAQMPDVYSSTPGGTIYSTTPG 218
           ++TDP + P+VY     G  Y    G
Sbjct: 449 VLTDPKKNPNVYKVETVGDKYMAVSG 474


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 9/26 (34%), Positives = 13/26 (50%)
 Frame = +3

Query: 141 LITDPAQMPDVYSSTPGGTIYSTTPG 218
           ++TDP + P+VY     G  Y    G
Sbjct: 449 VLTDPKKNPNVYKVETVGDKYMAVSG 474


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 212,331
Number of Sequences: 438
Number of extensions: 4386
Number of successful extensions: 16
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23632110
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)