BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00555 (785 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||... 29 1.00 SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyce... 26 7.0 >SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 28.7 bits (61), Expect = 1.00 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +1 Query: 361 SVGGGAWPFLVGGAICLVNSGNERDSSLLNRRRYLGVRGLVSRNSLTT 504 ++ G L G + ++N G E D L N RYL V L N++TT Sbjct: 44 NIDAGTMSPLEHGEVFVLNDGGEVDLDLGNYERYLNVT-LTHDNNITT 90 >SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1210 Score = 25.8 bits (54), Expect = 7.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 409 DKSLHQLRTAMHHHPPNQERAVNLSILPV 323 D +LH + +H + E A NLSILP+ Sbjct: 1061 DDNLHHGEIYLRNHILSDEMANNLSILPI 1089 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,325,594 Number of Sequences: 5004 Number of extensions: 69178 Number of successful extensions: 170 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 170 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -