BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00555 (785 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A prot... 27 0.66 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 25 2.7 AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 25 2.7 AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A prot... 25 2.7 AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A prot... 25 2.7 AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A prot... 25 2.7 AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A prot... 25 2.7 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 25 2.7 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 2.7 AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 prot... 25 2.7 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.1 >AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 27.1 bits (57), Expect = 0.66 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 279 QAPLLVVPSVNSFKFQLCNHTPPGVQNLWFPGSCPP 172 Q P+L+ S + KF +CNH P V CPP Sbjct: 29 QPPVLLAHSTDCDKFLICNHGTPVV------SKCPP 58 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 672 ARRSFSGLPGPLGQGEHADSFSVARV 595 A RS S L PLG HA +V RV Sbjct: 91 AGRSTSSLTVPLGTSRHASGGTVVRV 116 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 279 QAPLLVVPSVNSFKFQLCNHTPPGVQNLWFPGSCPP 172 Q P+L+ + KF +CNH P V CPP Sbjct: 29 QPPVLLAHPTDCDKFLICNHGTPVV------SKCPP 58 >AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 279 QAPLLVVPSVNSFKFQLCNHTPPGVQNLWFPGSCPP 172 Q P+L+ + KF +CNH P V CPP Sbjct: 29 QPPVLLAHPTDCDKFLICNHGTPVV------SQCPP 58 >AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 279 QAPLLVVPSVNSFKFQLCNHTPPGVQNLWFPGSCPP 172 Q P+L+ + KF +CNH P V CPP Sbjct: 29 QPPVLLAHPTDCDKFLICNHGTPVV------SKCPP 58 >AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 279 QAPLLVVPSVNSFKFQLCNHTPPGVQNLWFPGSCPP 172 Q P+L+ + KF +CNH P V CPP Sbjct: 29 QPPVLLAHPTDCDKFLICNHGTPVV------SKCPP 58 >AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 279 QAPLLVVPSVNSFKFQLCNHTPPGVQNLWFPGSCPP 172 Q P+L+ + KF +CNH P V CPP Sbjct: 29 QPPVLLAHPTDCDKFLICNHGTPVV------SKCPP 58 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 279 QAPLLVVPSVNSFKFQLCNHTPPGVQNLWFPGSCPP 172 Q P+L+ + KF +CNH P V CPP Sbjct: 29 QPPVLLAHPTDCDKFLICNHGTPVV------SKCPP 58 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 699 GDNCKPQSPARRSFSGLPGPLG 634 G C P+ A + GLPGP+G Sbjct: 91 GGCCLPKCFAEKGNRGLPGPMG 112 >AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 protein. Length = 153 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 279 QAPLLVVPSVNSFKFQLCNHTPPGVQNLWFPGSCPP 172 Q P+L+ + KF +CNH P V CPP Sbjct: 29 QPPVLLAHPTDCDKFLICNHGTPVV------SKCPP 58 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 8.1 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 265 QEWSLRLNLTQHGKYHQARTPEG 333 Q+W +R N + + RTP+G Sbjct: 1912 QQWEVRYNYDNANRLIRKRTPDG 1934 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 867,455 Number of Sequences: 2352 Number of extensions: 18864 Number of successful extensions: 39 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -