BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00554 (803 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 25 3.6 Z69982-1|CAA93822.1| 143|Anopheles gambiae lectin protein. 23 8.3 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 24.6 bits (51), Expect = 3.6 Identities = 25/70 (35%), Positives = 31/70 (44%), Gaps = 4/70 (5%) Frame = -1 Query: 602 PIDSDDLM*SKKFDSLSL-FGCVPIDKFAP---NGVLKLKLDHSENIAGFQYP*QNTYLG 435 PI +L S K DS SL F + P N +L LK H E + NT +G Sbjct: 198 PIFPPELKLSDKLDSESLVFRTSRTAWYRPTTLNDLLALKKAHPET----KIVVGNTEVG 253 Query: 434 CLVRLKHFSY 405 V+ KHF Y Sbjct: 254 VEVKFKHFEY 263 >Z69982-1|CAA93822.1| 143|Anopheles gambiae lectin protein. Length = 143 Score = 23.4 bits (48), Expect = 8.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 523 NLSIGTQPNKDRESNFLLHIKSSESMGVVLLN 618 N+++ T PN + + LHI GV++ N Sbjct: 39 NINLQTGPNTNPRDDTALHISIRPRDGVIIRN 70 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,532 Number of Sequences: 2352 Number of extensions: 12140 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -