BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00553 (791 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 25 0.61 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 25 0.61 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 2.5 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 3.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 3.3 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.9 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.9 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.4 bits (53), Expect = 0.61 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 643 TTSQRWSRGSTPRSLNTSRANNHHIKP 563 T +Q WSRG+T SL+ S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.4 bits (53), Expect = 0.61 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 643 TTSQRWSRGSTPRSLNTSRANNHHIKP 563 T +Q WSRG+T SL+ S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.4 bits (48), Expect = 2.5 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 Query: 645 PQHPSAGHGEAHHEASTLH 589 P H + GHG +H A+ H Sbjct: 414 PHHHTMGHGHSHIHATPHH 432 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 606 RGVLPRDQRWDVVVELFFYRDPEESEKDEQQAK 704 R +LPR ++ + +LF Y P SE ++ ++ Sbjct: 603 RLLLPRGKKEGMPFQLFLYVSPVSSEYNQYNSR 635 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 606 RGVLPRDQRWDVVVELFFYRDPEESEKDEQQAK 704 R +LPR ++ + +LF Y P SE ++ ++ Sbjct: 603 RLLLPRGKKEGMPFQLFLYVSPVSSEYNQYNSR 635 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 9.9 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +2 Query: 530 YPMQHQVFPLYWFDVVVV 583 +P ++++P Y+FD V+ Sbjct: 159 FPAIYEIYPNYFFDSSVI 176 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 9.9 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +2 Query: 530 YPMQHQVFPLYWFDVVVV 583 +P ++++P Y+FD V+ Sbjct: 159 FPAIYEIYPNYFFDSSVI 176 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 233,310 Number of Sequences: 438 Number of extensions: 5422 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -