BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00549 (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G10.07 |||nuclear cap-binding complex large subunit |Schizo... 27 2.0 SPBC3F6.02c |||3 beta-hydroxysteroid dehydrogenase/delta 5-->4-i... 25 8.0 SPBC32H8.02c |nep2|mug120|nedd8 protease Nep2|Schizosaccharomyce... 25 8.0 SPAC23D3.06c |nup146||nucleoporin Nup146|Schizosaccharomyces pom... 25 8.0 >SPAC6G10.07 |||nuclear cap-binding complex large subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 27.5 bits (58), Expect = 2.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 213 SPGIPSQSTTRRGVEYLHGELCS*SWHW*WQEWV 314 S +P Q T R +++ L + ++HW W EW+ Sbjct: 430 SSDLPLQ-TLDRFIDWFSHHLSNFNFHWKWNEWI 462 >SPBC3F6.02c |||3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase |Schizosaccharomyces pombe|chr 2|||Manual Length = 340 Score = 25.4 bits (53), Expect = 8.0 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 Query: 217 GEVPPYGLAFPRP 179 G VPPY + FPRP Sbjct: 258 GHVPPYIIKFPRP 270 >SPBC32H8.02c |nep2|mug120|nedd8 protease Nep2|Schizosaccharomyces pombe|chr 2|||Manual Length = 415 Score = 25.4 bits (53), Expect = 8.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 251 CGISAWGIVFLVVALVVAGMGFYYFSM 331 CGI + L+V V G+G+YY SM Sbjct: 164 CGIESGSHWSLLVVSVEKGLGWYYDSM 190 >SPAC23D3.06c |nup146||nucleoporin Nup146|Schizosaccharomyces pombe|chr 1|||Manual Length = 1325 Score = 25.4 bits (53), Expect = 8.0 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 359 LVCDKNKGSTLRNNRNPFLPLP 294 ++ DKNK ST+R + N +P P Sbjct: 443 VIKDKNKDSTVRASNNENIPTP 464 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,920,248 Number of Sequences: 5004 Number of extensions: 63299 Number of successful extensions: 143 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -