BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00549 (704 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0098 + 4235938-4237113 31 0.67 01_05_0705 + 24424457-24424948,24425520-24425624,24426097-244262... 31 0.89 12_02_0299 - 17051570-17052474,17053542-17053755 28 6.3 08_02_0169 + 13645705-13645838,13646190-13646262,13646359-13646685 28 6.3 04_01_0464 + 6006021-6006082,6006249-6006519 28 6.3 02_05_0635 + 30518833-30520290 28 6.3 08_01_0576 - 5114636-5115151,5115254-5116183,5116898-5117614,511... 28 8.3 07_03_1175 - 24555965-24556117,24557809-24558264,24558270-245584... 28 8.3 02_05_1269 + 35352825-35352888,35353645-35353968,35355062-353551... 28 8.3 >09_02_0098 + 4235938-4237113 Length = 391 Score = 31.5 bits (68), Expect = 0.67 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -2 Query: 223 IPGEVPPYGLAFPRPWFPLPYL-LF-PRLVATQSVASCS 113 IPG +PP G ++P P P P L LF P A++ A CS Sbjct: 202 IPGFLPPPGFSYPEPMGPPPLLSLFPPARDASRIAAVCS 240 >01_05_0705 + 24424457-24424948,24425520-24425624,24426097-24426207, 24426675-24426857,24427066-24427192,24427336-24427397, 24427638-24427724,24428703-24428789,24429210-24429323, 24429507-24429635,24429834-24429896,24430333-24430494, 24430611-24430729,24430786-24431794 Length = 949 Score = 31.1 bits (67), Expect = 0.89 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +3 Query: 120 DATLCVATNRGNSKYGSGNQGLGKAKPYGGTSPGIPSQSTTR 245 + T +A N + GN LG P GG S G S STT+ Sbjct: 860 NTTNLMAVNSTGNYLNQGNSALGFGNPIGGRSTGSLSSSTTQ 901 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -2 Query: 220 PGEVPPYGLAFPRPWF-PLPYLLFP 149 P PP PRPWF P+P+L P Sbjct: 211 PWPWPPIPFCTPRPWFPPIPFLTPP 235 >08_02_0169 + 13645705-13645838,13646190-13646262,13646359-13646685 Length = 177 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +3 Query: 120 DATLCVATNRGNSKYGSGNQGLGKAKPYGGTSPGIPSQSTTRRG 251 D T AT G +K A G +PG+P ST RRG Sbjct: 37 DRTEATATGEGAAKEEGDEVQPTAATAQQGGAPGMPGTSTARRG 80 >04_01_0464 + 6006021-6006082,6006249-6006519 Length = 110 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 156 SKYGSGNQGLGKAKPYGGTSPGIPSQSTTRR 248 S+ G+G+ G G G T PG+ + RR Sbjct: 49 SERGTGDHGAGSGTEQGATEPGVAGRGELRR 79 >02_05_0635 + 30518833-30520290 Length = 485 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +2 Query: 215 PGYTFTEHHKAWCGISAWGIVFLVVALVVAGMGFYYFSMCYPYFCH 352 P TF EH + W G + F+ L +G+G C PY H Sbjct: 97 PFATFLEHSRVWPGFEERSVRFMTRLLERSGLG---EETCLPYAQH 139 >08_01_0576 - 5114636-5115151,5115254-5116183,5116898-5117614, 5119630-5119746,5119930-5120295,5121365-5121634 Length = 971 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 Query: 223 IPGEVPPYGLAFPRPWFPLPYL 158 +P VPPYGL P FPLP L Sbjct: 735 VPPAVPPYGLQ-SMPGFPLPSL 755 >07_03_1175 - 24555965-24556117,24557809-24558264,24558270-24558436, 24558468-24558756,24559620-24559726,24559841-24559909, 24560001-24560109 Length = 449 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +3 Query: 147 RGNSKYGSGNQGLGKAKPYGGTSPGIPSQSTTRRGVEYLHG 269 RG G+G G G+A YGG G S S LHG Sbjct: 144 RGGGYAGNGGYG-GRASEYGGYGAGGYSSSGGYNATSVLHG 183 >02_05_1269 + 35352825-35352888,35353645-35353968,35355062-35355183, 35355361-35355482,35355651-35355755,35356402-35356765, 35357181-35357321,35357619-35359109 Length = 910 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 217 RVYLHRAPQGVVWNICMGNCVLSRGTGSGRN 309 +V L +P +W +C GN + +R G N Sbjct: 223 KVQLKASPSCKIWFVCKGNLICTREVNEGLN 253 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,100,350 Number of Sequences: 37544 Number of extensions: 389993 Number of successful extensions: 909 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 909 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -