BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00546 (416 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) 138 1e-33 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 27 8.2 SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) 27 8.2 >SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) Length = 289 Score = 138 bits (335), Expect = 1e-33 Identities = 68/93 (73%), Positives = 75/93 (80%), Gaps = 4/93 (4%) Frame = +2 Query: 35 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 214 MT+KR NGGR+KHGRGHVK VRCTNCARCVPKDK+IKKFVIRNIVEAAAVRDI DASVY Sbjct: 1 MTKKRCNGGRSKHGRGHVKFVRCTNCARCVPKDKSIKKFVIRNIVEAAAVRDIADASVYE 60 Query: 215 MFQLPKLYAKLHY--SC--HAPSTAKLSGTDRR 301 ++ LPKLY KLHY SC H+ S DR+ Sbjct: 61 VYALPKLYVKLHYCVSCAIHSKVVRNRSKEDRK 93 Score = 51.2 bits (117), Expect = 3e-07 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +1 Query: 256 VSCAIHSKVVRNRSKKDRRIRTPP 327 VSCAIHSKVVRNRSK+DR+IRTPP Sbjct: 75 VSCAIHSKVVRNRSKEDRKIRTPP 98 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 26.6 bits (56), Expect = 8.2 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = +2 Query: 35 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 214 M ++ N K+ R + TNC +K K +NI+ + D D+S+YP Sbjct: 1819 MLYRQNNWYYIKNSRNTEGFIPFTNCIAEDEYEKRQNKLSRQNIIRNTSFLDSMDSSIYP 1878 >SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 842 Score = 26.6 bits (56), Expect = 8.2 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 122 VPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKL 235 + K K + VI + A AV D++ +VYP+F P L Sbjct: 47 IVKKKRNEGKVIYLFIGALAVTDVSLLAVYPLFAFPVL 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,637,633 Number of Sequences: 59808 Number of extensions: 212780 Number of successful extensions: 526 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -