BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00545 (793 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11G11.07 ||SPBC18H10.01|karyopherin|Schizosaccharomyces pomb... 26 7.1 SPAC4F10.09c |||ribosome biogenesis protein Noc1 |Schizosaccharo... 26 7.1 >SPBC11G11.07 ||SPBC18H10.01|karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 955 Score = 25.8 bits (54), Expect = 7.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 96 ISQLFNGCYYTYKPSSLITLPI 31 IS+L YT+K +++TLP+ Sbjct: 673 ISKLLKNFIYTFKEKAIVTLPV 694 >SPAC4F10.09c |||ribosome biogenesis protein Noc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 860 Score = 25.8 bits (54), Expect = 7.1 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 336 KLHLNKSILRFIIHIDST*TQCYRDIKTMLRYFFQSTHKQI 458 KL + K I RFI ++ T CY + T+ + THKQ+ Sbjct: 264 KLVITKEIERFIFAPSTSRTSCYYTLITLNQTVL--THKQV 302 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,951,738 Number of Sequences: 5004 Number of extensions: 57146 Number of successful extensions: 119 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -