BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00545 (793 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50535| Best HMM Match : PPE (HMM E-Value=1.1) 29 5.7 SB_33902| Best HMM Match : Metallothionein (HMM E-Value=0.71) 28 7.5 >SB_50535| Best HMM Match : PPE (HMM E-Value=1.1) Length = 299 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +3 Query: 381 DST*TQCYRDIKTMLRYFFQSTHKQIITF-KKIPTKILQVLAASNLEVTNHCELHLISTP 557 DS +C I LR+ + TF KK T+ L +S L+ +NHC +L S P Sbjct: 214 DSVPFRCVAKISLKLRHVLSFKAILLTTFYKKRFTRPLSDQPSSELQTSNHCLGYLCSFP 273 >SB_33902| Best HMM Match : Metallothionein (HMM E-Value=0.71) Length = 361 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 399 CYRDIKTMLRYFFQSTHKQIITFKKIPTKILQVLAASNLEV-TNHCE 536 C I+ +L + +THK +IT +PT+I Q + S ++ T+H E Sbjct: 63 CRSVIRDVLFHAHTATHKLVITGDDVPTEIHQGVVISRDDISTSHEE 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,736,514 Number of Sequences: 59808 Number of extensions: 374485 Number of successful extensions: 628 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 627 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -