BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00545 (793 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. 24 4.7 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 23 8.2 >AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. Length = 356 Score = 24.2 bits (50), Expect = 4.7 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -2 Query: 111 CNLL-LISQLFNGCYYTYKPSSLITLPIKKT 22 C+ L IS++ C+Y + + L +L IKKT Sbjct: 321 CDTLHAISKVMKECWYQHPAARLSSLRIKKT 351 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 23.4 bits (48), Expect = 8.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 132 PLLRFGNCNLLLISQLFNGCYYTYKPSSL 46 PLL G +++S+L+ G + K SSL Sbjct: 286 PLLTMGFAYSMIVSKLWRGLRHEIKHSSL 314 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,064 Number of Sequences: 2352 Number of extensions: 13531 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -