BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00544 (797 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40421-5|AAA81441.1| 133|Caenorhabditis elegans Hypothetical pr... 28 6.7 AF067936-4|AAC19210.1| 903|Caenorhabditis elegans Hypothetical ... 28 8.9 >U40421-5|AAA81441.1| 133|Caenorhabditis elegans Hypothetical protein C02B8.3 protein. Length = 133 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +3 Query: 555 DPDAQQRWLSMTYPVDIDLSAYRPVPEKQVVYHLQSVEQDSEPVNTDMVTF 707 D D + +M+ PV L +Y P P+ +H+ V+ DS+ T + F Sbjct: 22 DSDDLSKGHTMSDPV-YQLCSYMPSPKDYNKFHVNGVQMDSDDYTTILTMF 71 >AF067936-4|AAC19210.1| 903|Caenorhabditis elegans Hypothetical protein C24G6.2a protein. Length = 903 Score = 27.9 bits (59), Expect = 8.9 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 597 VDIDLSAYRPVPEKQVVYHLQSVEQDSEPVNTDMVTFNCTVAYMSQCMSCDKC 755 VD DLS PVP+ V H+++ S + +DM+ C Y Q + KC Sbjct: 233 VDPDLSQGIPVPDFDV--HVKN-STISTSIGSDMMDRKCRYVYYLQSVMSKKC 282 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,179,828 Number of Sequences: 27780 Number of extensions: 343077 Number of successful extensions: 895 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -