BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00543 (771 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X62515-1|CAA44373.1| 4393|Homo sapiens Human basement membrane h... 30 8.0 M85289-1|AAA52700.1| 4391|Homo sapiens heparan sulfate proteogly... 30 8.0 AL590556-2|CAH71870.1| 4391|Homo sapiens heparan sulfate proteog... 30 8.0 AL590103-2|CAI12125.1| 4391|Homo sapiens heparan sulfate proteog... 30 8.0 AL445795-1|CAC18534.1| 4370|Homo sapiens heparan sulfate proteog... 30 8.0 AB209851-1|BAD93088.1| 2331|Homo sapiens Basement membrane-speci... 30 8.0 >X62515-1|CAA44373.1| 4393|Homo sapiens Human basement membrane heparan sulfate proteoglycan core protein protein. Length = 4393 Score = 30.3 bits (65), Expect = 8.0 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -3 Query: 214 AYLSVASEQVRIKLSS*NQTKGQLLSFHC*IGPGLSHVASEREKKGNN 71 AY + +++ +RI+ SS +GQ L +C + PG SH K+G + Sbjct: 2336 AYPAGSTQPIRIEPSSSQVAEGQTLDLNC-VVPGQSHAQVTWHKRGGS 2382 >M85289-1|AAA52700.1| 4391|Homo sapiens heparan sulfate proteoglycan protein. Length = 4391 Score = 30.3 bits (65), Expect = 8.0 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -3 Query: 214 AYLSVASEQVRIKLSS*NQTKGQLLSFHC*IGPGLSHVASEREKKGNN 71 AY + +++ +RI+ SS +GQ L +C + PG SH K+G + Sbjct: 2334 AYPAGSTQPIRIEPSSSQVAEGQTLDLNC-VVPGQSHAQVTWHKRGGS 2380 >AL590556-2|CAH71870.1| 4391|Homo sapiens heparan sulfate proteoglycan 2 protein. Length = 4391 Score = 30.3 bits (65), Expect = 8.0 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -3 Query: 214 AYLSVASEQVRIKLSS*NQTKGQLLSFHC*IGPGLSHVASEREKKGNN 71 AY + +++ +RI+ SS +GQ L +C + PG SH K+G + Sbjct: 2334 AYPAGSTQPIRIEPSSSQVAEGQTLDLNC-VVPGQSHAQVTWHKRGGS 2380 >AL590103-2|CAI12125.1| 4391|Homo sapiens heparan sulfate proteoglycan 2 protein. Length = 4391 Score = 30.3 bits (65), Expect = 8.0 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -3 Query: 214 AYLSVASEQVRIKLSS*NQTKGQLLSFHC*IGPGLSHVASEREKKGNN 71 AY + +++ +RI+ SS +GQ L +C + PG SH K+G + Sbjct: 2334 AYPAGSTQPIRIEPSSSQVAEGQTLDLNC-VVPGQSHAQVTWHKRGGS 2380 >AL445795-1|CAC18534.1| 4370|Homo sapiens heparan sulfate proteoglycan perlecan protein. Length = 4370 Score = 30.3 bits (65), Expect = 8.0 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -3 Query: 214 AYLSVASEQVRIKLSS*NQTKGQLLSFHC*IGPGLSHVASEREKKGNN 71 AY + +++ +RI+ SS +GQ L +C + PG SH K+G + Sbjct: 2313 AYPAGSTQPIRIEPSSSQVAEGQTLDLNC-VVPGQSHAQVTWHKRGGS 2359 >AB209851-1|BAD93088.1| 2331|Homo sapiens Basement membrane-specific heparan sulfate proteoglycan core protein precursor protein. Length = 2331 Score = 30.3 bits (65), Expect = 8.0 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -3 Query: 214 AYLSVASEQVRIKLSS*NQTKGQLLSFHC*IGPGLSHVASEREKKGNN 71 AY + +++ +RI+ SS +GQ L +C + PG SH K+G + Sbjct: 274 AYPAGSTQPIRIEPSSSQVAEGQTLDLNC-VVPGQSHAQVTWHKRGGS 320 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,151,903 Number of Sequences: 237096 Number of extensions: 2192639 Number of successful extensions: 3016 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3009 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9311505506 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -