BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00542 (785 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 46 1e-06 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 25 2.0 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 25 2.0 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 25 2.0 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 25 2.0 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 46.4 bits (105), Expect = 1e-06 Identities = 21/78 (26%), Positives = 41/78 (52%) Frame = +2 Query: 254 SWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSP 433 +WCG CK +AP+ + K A++ I + KVD + ++LA Y + PT F + Sbjct: 30 TWCGPCKVIAPKLEEFQNKYADK---IVVVKVDVDECEELAAQYNIASMPTFLFIKRKEV 86 Query: 434 IDYSGGRQADDIISWLKK 487 + G A+ + +++++ Sbjct: 87 VGQFSGANAEKLENFIQQ 104 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 25.4 bits (53), Expect = 2.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 582 VRKETKYNNSIGIDKFFSLFSRGNLTAGGPVF 487 V ETKYN+ + +FF + G G +F Sbjct: 66 VSDETKYNDFAQVAEFFDYYKTGAFLEKGELF 97 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 2.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 582 VRKETKYNNSIGIDKFFSLFSRGNLTAGGPVF 487 V ETKYN+ + +FF + G G +F Sbjct: 66 VSDETKYNDFAQVAEFFDYYKTGAFLEKGELF 97 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 2.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 582 VRKETKYNNSIGIDKFFSLFSRGNLTAGGPVF 487 V ETKYN+ + +FF + G G +F Sbjct: 66 VSDETKYNDFAQVAEFFDYYKTGAFLEKGELF 97 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 2.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 582 VRKETKYNNSIGIDKFFSLFSRGNLTAGGPVF 487 V ETKYN+ + +FF + G G +F Sbjct: 66 VSDETKYNDFAQVAEFFDYYKTGAFLEKGELF 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 733,161 Number of Sequences: 2352 Number of extensions: 14283 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -