BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00541 (796 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6ET68 Cluster: Putative uncharacterized protein; n=1; ... 34 4.7 UniRef50_UPI0000F20E33 Cluster: PREDICTED: hypothetical protein;... 33 8.3 UniRef50_Q4PA90 Cluster: Predicted protein; n=1; Ustilago maydis... 33 8.3 >UniRef50_A6ET68 Cluster: Putative uncharacterized protein; n=1; unidentified eubacterium SCB49|Rep: Putative uncharacterized protein - unidentified eubacterium SCB49 Length = 526 Score = 33.9 bits (74), Expect = 4.7 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -2 Query: 411 DNCHNMIFFLLSIAHLKNYP*FYIKYLIMSGVGQFLQY 298 ++ N I LL ++H K YP FYIKY++ + +F Y Sbjct: 327 EHFENGINLLLELSHKKEYPEFYIKYILYTRNLEFAYY 364 >UniRef50_UPI0000F20E33 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 264 Score = 33.1 bits (72), Expect = 8.3 Identities = 20/73 (27%), Positives = 34/73 (46%) Frame = -3 Query: 788 NLVLSDYRSHDINNTIPIHLET*SLNHNCIVHRPPQSSNRRHDCLAEEPGMVLVPTHVAS 609 N +LS D+NN+ P+H+E +++C+V P S+ +H E P Sbjct: 194 NRLLSSISVSDLNNSFPLHMECLDGSYSCVVSN-PISNQTQHVNNTEH----CQPCSDVG 248 Query: 608 PDFQISSASNLFN 570 D ++ S + FN Sbjct: 249 KDLKVDSTESTFN 261 >UniRef50_Q4PA90 Cluster: Predicted protein; n=1; Ustilago maydis|Rep: Predicted protein - Ustilago maydis (Smut fungus) Length = 371 Score = 33.1 bits (72), Expect = 8.3 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = -3 Query: 701 IVHRPPQSSNRRHDCLAEEPGMVLVPTHVASPDFQISSASNLFNKHTHLTHITFCVIQE* 522 + R P S+ ++ LAEE +++P ASP F++ + +F ++ + +TF + Sbjct: 69 LAFRLPPRSSFFNNALAEESTTIVIPLFDASPRFELDRHA-IFERNRRIVSLTFGDVSRV 127 Query: 521 CI 516 CI Sbjct: 128 CI 129 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 748,319,349 Number of Sequences: 1657284 Number of extensions: 15275825 Number of successful extensions: 28522 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28519 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 67908372675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -