BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00541 (796 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z67879-6|CAA91791.2| 1482|Caenorhabditis elegans Hypothetical pr... 29 3.8 AL023817-1|CAA19436.2| 1482|Caenorhabditis elegans Hypothetical ... 29 3.8 >Z67879-6|CAA91791.2| 1482|Caenorhabditis elegans Hypothetical protein VF11C1L.1 protein. Length = 1482 Score = 29.1 bits (62), Expect = 3.8 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -3 Query: 689 PPQSSNRRHDCLAEEPGMVLVPTHVASPDFQISSASNLFNKHTH 558 PPQ +RR+ LA+ VPT ++ D S+++ L N H+H Sbjct: 235 PPQLGSRRNS-LAQSSNGPGVPTILSVADLCASNSAMLTNSHSH 277 >AL023817-1|CAA19436.2| 1482|Caenorhabditis elegans Hypothetical protein VF11C1L.1 protein. Length = 1482 Score = 29.1 bits (62), Expect = 3.8 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -3 Query: 689 PPQSSNRRHDCLAEEPGMVLVPTHVASPDFQISSASNLFNKHTH 558 PPQ +RR+ LA+ VPT ++ D S+++ L N H+H Sbjct: 235 PPQLGSRRNS-LAQSSNGPGVPTILSVADLCASNSAMLTNSHSH 277 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,724,362 Number of Sequences: 27780 Number of extensions: 377424 Number of successful extensions: 744 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1935274832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -