BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00540 (660 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0120 + 6984482-6984643,6984748-6984797,6984936-6984996,698... 30 1.4 08_02_0210 + 14324539-14324609,14324735-14325740,14325838-143273... 29 4.3 >02_02_0120 + 6984482-6984643,6984748-6984797,6984936-6984996, 6985574-6985669,6985754-6985903,6986208-6986339, 6986641-6986768,6987285-6987327,6987935-6988018, 6989049-6989090,6989264-6989334,6989621-6989674, 6989789-6989894,6990038-6990106,6990824-6990967, 6992038-6992113,6992295-6992353 Length = 508 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 8 RNSSSRNNSKPALYSTNSNVEPDLSTFHKVL 100 +N+ S N SKPA + + DLST H +L Sbjct: 159 KNTDSGNYSKPASFEGMEKFDSDLSTLHPIL 189 >08_02_0210 + 14324539-14324609,14324735-14325740,14325838-14327390, 14327473-14327601,14328345-14328510 Length = 974 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 44 LYSTNSNVEPDLSTFHKVLFSNL*FTK 124 ++ TNS+V+P L T+HK+L+ F++ Sbjct: 617 IHETNSDVKPYLETYHKLLWMRSKFSE 643 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,424,868 Number of Sequences: 37544 Number of extensions: 223965 Number of successful extensions: 327 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -