BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00540 (660 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119595-1|AAM50249.1| 377|Drosophila melanogaster LD18062p pro... 29 4.2 AE013599-597|AAM68851.1| 377|Drosophila melanogaster CG11508-PB... 29 4.2 AE013599-596|AAF59128.3| 377|Drosophila melanogaster CG11508-PA... 29 4.2 >AY119595-1|AAM50249.1| 377|Drosophila melanogaster LD18062p protein. Length = 377 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -3 Query: 286 KHRKLPFQQTQFSHNIHRDVLIEKSVTFPFL*IEA*NLLQITITLYK 146 K RK PF +TQ+SH ++ P L I+A L++T+ LY+ Sbjct: 98 KSRKCPFGRTQYSHKLN-----PTPTDSPNLHIDACGELELTVRLYR 139 >AE013599-597|AAM68851.1| 377|Drosophila melanogaster CG11508-PB, isoform B protein. Length = 377 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -3 Query: 286 KHRKLPFQQTQFSHNIHRDVLIEKSVTFPFL*IEA*NLLQITITLYK 146 K RK PF +TQ+SH ++ P L I+A L++T+ LY+ Sbjct: 98 KSRKCPFGRTQYSHKLN-----PTPTDSPNLHIDACGELELTVRLYR 139 >AE013599-596|AAF59128.3| 377|Drosophila melanogaster CG11508-PA, isoform A protein. Length = 377 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -3 Query: 286 KHRKLPFQQTQFSHNIHRDVLIEKSVTFPFL*IEA*NLLQITITLYK 146 K RK PF +TQ+SH ++ P L I+A L++T+ LY+ Sbjct: 98 KSRKCPFGRTQYSHKLN-----PTPTDSPNLHIDACGELELTVRLYR 139 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,514,513 Number of Sequences: 53049 Number of extensions: 447039 Number of successful extensions: 817 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2827453950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -