BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00537 (770 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 25 0.51 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 24 1.5 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 24 1.5 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 6.2 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 8.2 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 21 8.2 AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII pr... 21 8.2 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 25.4 bits (53), Expect = 0.51 Identities = 14/57 (24%), Positives = 25/57 (43%) Frame = -1 Query: 398 ANLVIKPSTDKTNNIHNVSK*QAFFHHFT*YNFKDVGKTIQNLAPHIGSHFR*NTVL 228 ++ V P + + K +A F ++ Y+F + + + PH G H NT L Sbjct: 402 SSFVTLPQLHSLDEWDDTLKEKADFQYYVSYDFYKMNHPVYHKDPHYGFHNVTNTTL 458 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 17 LPFLSYKLECKNVMCVLLTSLVHYHNKKKPTSVINLCTK 133 +PF+ + +V+ +L S Y+ KP +CTK Sbjct: 146 VPFVELTVAHASVLTILAISFERYYAICKPLKAGYICTK 184 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 17 LPFLSYKLECKNVMCVLLTSLVHYHNKKKPTSVINLCTK 133 +PF+ + +V+ +L S Y+ KP +CTK Sbjct: 146 VPFVELTVAHASVLTILAISFERYYAICKPLKAGYICTK 184 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 259 ICGAKFWMVLPTSLKLYYVKW*KKACHLL 345 I G F ++ + LK+Y+ + +K C +L Sbjct: 13 IAGFLFLLICDSYLKIYHKEKYRKFCRIL 41 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 627 SLVKLPSNYTIVQKF 671 +L KLP NY I KF Sbjct: 403 TLYKLPPNYEIRHKF 417 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 436 ILCKYHQAYSNEMVFQ 483 +L KYHQ + ++ +FQ Sbjct: 10 MLPKYHQQFHHQQLFQ 25 >AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII protein. Length = 209 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 436 ILCKYHQAYSNEMVFQ 483 +L KYHQ + ++ +FQ Sbjct: 10 MLPKYHQQFHHQQLFQ 25 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,177 Number of Sequences: 336 Number of extensions: 4143 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -