BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00537 (770 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 28 1.3 SPBC725.04 |||oxalyl-CoA decarboxylase |Schizosaccharomyces pomb... 25 9.1 >SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 106 Score = 28.3 bits (60), Expect = 1.3 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -2 Query: 379 HLLIKQITFIM*ANDKPFFTILHNTTLKMLVKPSKI*HHILALTFVKILFC 227 HL+ Q F ++ +ILHN L + SK +H LT V++ FC Sbjct: 42 HLMTSQHIFKCLSSCNYALSILHNICLASFLYLSKCYYHTHILTSVRLDFC 92 >SPBC725.04 |||oxalyl-CoA decarboxylase |Schizosaccharomyces pombe|chr 2|||Manual Length = 574 Score = 25.4 bits (53), Expect = 9.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 592 WVANSKFVQITTNAK 548 W N+KF+QI TNA+ Sbjct: 284 WSPNAKFIQIDTNAE 298 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,127,662 Number of Sequences: 5004 Number of extensions: 64351 Number of successful extensions: 107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -