BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00537 (770 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0148 - 21214460-21214561,21214993-21215339,21215428-212155... 28 7.2 09_04_0712 + 19670279-19670570,19670676-19670767,19671360-196714... 28 9.5 >09_06_0148 - 21214460-21214561,21214993-21215339,21215428-21215538, 21215673-21215835,21215921-21215999,21216110-21216228 Length = 306 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 392 NWPNFMTFTLLCLHRYYVSIIKHIQMKWFFR 484 ++P T L RYY+S++ H + +FFR Sbjct: 81 SFPATTTSASYVLRRYYLSLLHHYEQVYFFR 111 >09_04_0712 + 19670279-19670570,19670676-19670767,19671360-19671487, 19671615-19671750,19671838-19671889,19671994-19672094, 19672577-19672753,19673370-19673527,19674002-19674107, 19674636-19674806 Length = 470 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 330 GLSFAYIMNVICFISRWLYHQI 395 GL F Y F+SRW+ HQ+ Sbjct: 246 GLQFVYGFESFFFVSRWVMHQL 267 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,615,927 Number of Sequences: 37544 Number of extensions: 322810 Number of successful extensions: 471 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 471 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -