BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00531 (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 25 0.81 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 5.7 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 5.7 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 5.7 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 5.7 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 25.0 bits (52), Expect = 0.81 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = -2 Query: 595 LQISSHFLAKSMHLPTSCLL 536 +++ SH ++K +H+P S L+ Sbjct: 131 IELISHIISKQLHIPVSVLM 150 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 247 CKNIVFGVNLAAVNAIPVPLITAKVNLRPV 158 CK + + +N IPVP+ RP+ Sbjct: 104 CKKLYYNINYIEQIPIPVPVYYGNFPPRPM 133 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 247 CKNIVFGVNLAAVNAIPVPLITAKVNLRPV 158 CK + + +N IPVP+ RP+ Sbjct: 109 CKKLYYNINYIEQIPIPVPVYYGNFPPRPM 138 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 247 CKNIVFGVNLAAVNAIPVPLITAKVNLRPV 158 CK + + +N IPVP+ RP+ Sbjct: 109 CKKLYYNINYIEQIPIPVPVYYGNFPPRPM 138 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 247 CKNIVFGVNLAAVNAIPVPLITAKVNLRPV 158 CK + + +N IPVP+ RP+ Sbjct: 109 CKKLYYNINYIEQIPIPVPVYYGNFPPRPM 138 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,196 Number of Sequences: 438 Number of extensions: 4457 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -