BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00530 (797 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752897-1|AAV30071.1| 107|Anopheles gambiae peroxidase 4B prot... 26 1.6 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 25 3.6 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 24 6.3 >AY752897-1|AAV30071.1| 107|Anopheles gambiae peroxidase 4B protein. Length = 107 Score = 25.8 bits (54), Expect = 1.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +2 Query: 392 DVLENVTLSVAGRVHSIRESGA 457 D +++V L+VAG + S RE+GA Sbjct: 56 DTVDDVELAVAGALESHREAGA 77 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 619 ELSIIPKNIKLLAPCLHMLPHLHFGLKDKETRFRKRYLDLILNDKVRQ 762 EL++ P+ + C+ + H G + +YLD ILN+ +R+ Sbjct: 319 ELALNPEVQEKGRECVREILQKHNGEMSYDAVVEMKYLDQILNESLRK 366 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -3 Query: 225 MVSFQRQRPAVVKLFRPSPLTFLQLSTFVSVRFSKF 118 ++ + QRP V+K+ P+T ++V +S F Sbjct: 335 LIIARAQRPMVIKVGNVYPMTLEMFQKLLNVSYSYF 370 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 714,868 Number of Sequences: 2352 Number of extensions: 12774 Number of successful extensions: 44 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -