BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00529 (790 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) 36 0.028 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 36 0.028 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.049 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.086 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 33 0.20 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 32 0.46 SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) 32 0.61 SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 31 1.4 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 31 1.4 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 31 1.4 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 31 1.4 SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) 30 2.5 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 29 3.2 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 29 3.2 SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) 29 3.2 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 29 3.2 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 29 3.2 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 29 3.2 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 29 3.2 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.2 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 29 3.2 SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 29 3.2 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.2 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 29 3.2 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 29 3.2 SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) 29 4.3 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 29 5.7 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 28 7.5 SB_26191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_8382| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 28 9.9 SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = +3 Query: 510 PLGLRRDFGSLCILYCMFHGECSEELFEMI-PASHFYHRTARHRSRVHPYYLEPLRSSTV 686 PL RRD L +L+ + +G+ S L ++ PA+ Y+ H + ++ + Sbjct: 192 PLEYRRDITDLVLLFKIKNGDVSISLASLLSPATSRYNTRNYHSNNYRLFFTH----NQN 247 Query: 687 CFQRYFLLRTIRLWNELPS 743 ++ + RT++LWN LPS Sbjct: 248 YYRNSYFPRTVKLWNSLPS 266 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 36.3 bits (80), Expect = 0.028 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 1/79 (1%) Frame = +3 Query: 510 PLGLRRDFGSLCILYCMFHGECSEELFEMI-PASHFYHRTARHRSRVHPYYLEPLRSSTV 686 PL RRD L +L+ + +G+ S ++ PA+ Y+ + H + Y L + Sbjct: 689 PLEYRRDITDLVLLFKIKNGDVSISSASLLSPATSRYNTRSYHPNN---YRLFSTHNQNY 745 Query: 687 CFQRYFLLRTIRLWNELPS 743 YF RT++LWN LPS Sbjct: 746 YRNSYFP-RTVKLWNSLPS 763 >SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) Length = 210 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/76 (31%), Positives = 37/76 (48%) Frame = +3 Query: 522 RRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCFQRY 701 +R S IL+ FH ++ +P R+ R R YY + L+++T+ F Sbjct: 112 QRRLTSQAILFYKFHNSL---IYAKLP--DLVTRSTRSTRRKELYYNQ-LQANTLAFNYS 165 Query: 702 FLLRTIRLWNELPSTV 749 F R IR+WN LP+ V Sbjct: 166 FFARAIRIWNLLPNDV 181 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 36.3 bits (80), Expect = 0.028 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 1/79 (1%) Frame = +3 Query: 510 PLGLRRDFGSLCILYCMFHGECSEELFEMI-PASHFYHRTARHRSRVHPYYLEPLRSSTV 686 PL RRD L +L+ + +G+ S ++ PA+ Y+ + H + Y L + Sbjct: 192 PLEYRRDITDLVLLFKIKNGDVSISSASLLSPATSRYNTRSYHPNN---YRLFSTHNQNY 248 Query: 687 CFQRYFLLRTIRLWNELPS 743 YF RT++LWN LPS Sbjct: 249 YRNSYFP-RTVKLWNSLPS 266 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/76 (31%), Positives = 37/76 (48%) Frame = +3 Query: 522 RRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCFQRY 701 +R S IL+ FH ++ +P R+ R R YY + L+++T+ F Sbjct: 472 QRRLTSQAILFYKFHNSL---IYAKLP--DLVTRSTRSTRRKELYYNQ-LQANTLAFNYS 525 Query: 702 FLLRTIRLWNELPSTV 749 F R IR+WN LP+ V Sbjct: 526 FFARAIRIWNLLPNDV 541 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +3 Query: 630 RHRSRVHPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTVFTERLTCP 773 R R HP PL +S+ F RTI WN LP+ +F E + P Sbjct: 823 RKTRRSHPESFIPLSTSSASEHLSFFSRTIIQWNNLPALLFNEPCSLP 870 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 34.7 bits (76), Expect = 0.086 Identities = 24/76 (31%), Positives = 36/76 (47%) Frame = +3 Query: 522 RRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCFQRY 701 +R S IL+ FH + +P R+ R R YY + L+++T+ F Sbjct: 266 QRRLTSQAILFYKFHNSL---IHAKLP--DLVTRSTRSTRRKELYYNQ-LQANTLAFNYS 319 Query: 702 FLLRTIRLWNELPSTV 749 F R IR+WN LP+ V Sbjct: 320 FFARAIRIWNLLPNDV 335 >SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +3 Query: 621 RTARHRSRVHPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTV 749 R+ R R YY + L+++T+ F F R IR+WN LP+ V Sbjct: 245 RSTRSTRRKELYYNQ-LQANTLAFNYSFFARAIRIWNLLPNDV 286 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 33.5 bits (73), Expect = 0.20 Identities = 23/76 (30%), Positives = 35/76 (46%) Frame = +3 Query: 522 RRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCFQRY 701 +R S IL+ FH ++ +P R+ R R Y L+++T+ F Sbjct: 1182 QRRLTSQAILFYKFHNSL---IYAKLP--DLVTRSTRSTRRKE-LYCNQLQANTLTFNYS 1235 Query: 702 FLLRTIRLWNELPSTV 749 F R IR+WN LP+ V Sbjct: 1236 FFARAIRIWNLLPNDV 1251 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 32.3 bits (70), Expect = 0.46 Identities = 23/79 (29%), Positives = 32/79 (40%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L +RR LC+ Y + L + F R R+ Y ++S+ + Sbjct: 143 LEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRRSRTNSSKY--NQIQSNVLSH 195 Query: 693 QRYFLLRTIRLWNELPSTV 749 F RTIR WN LPS V Sbjct: 196 SYSFFPRTIRTWNLLPSEV 214 >SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) Length = 294 Score = 31.9 bits (69), Expect = 0.61 Identities = 24/77 (31%), Positives = 36/77 (46%) Frame = +3 Query: 510 PLGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVC 689 PL RR L + Y + + + E+ + I RT + RS HP L +T Sbjct: 205 PLSKRRQNARLTLFYKAVNKKSALEIPDNID-----RRTRQLRSS-HPDKFIELCPTTEA 258 Query: 690 FQRYFLLRTIRLWNELP 740 ++ F RTI+ WN+LP Sbjct: 259 YKNSFFCRTIKEWNKLP 275 >SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 639 SRVHPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTVFTE 758 +R H + L+S+ + + F R IR+WN LPS V + Sbjct: 122 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNVINQ 161 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 600 PASHFYHRTARHRS-RVHPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTV 749 P+ + R RS R H L+++ + F F RTIR WN LP+ V Sbjct: 1059 PSEYDLRRNENIRSSRRHSRTYHQLQANILAFNYSFFPRTIRTWNLLPAEV 1109 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 639 SRVHPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTV 749 SR H L+++ + F F RTIR WN LP+ V Sbjct: 1627 SRRHSRTYHQLQANILAFNYSFFPRTIRTWNLLPAEV 1663 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 30.7 bits (66), Expect = 1.4 Identities = 24/77 (31%), Positives = 35/77 (45%) Frame = +3 Query: 510 PLGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVC 689 PL RR L + Y + + + ++ + I RT + RS HP L T Sbjct: 314 PLSKRRQDARLTLFYKAVNKKSALKIPDNID-----RRTRQLRSS-HPDKFIELCPRTEA 367 Query: 690 FQRYFLLRTIRLWNELP 740 F+ F RTI+ WN+LP Sbjct: 368 FKNSFFCRTIKEWNKLP 384 >SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 506 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 639 SRVHPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTVFTE 758 +R H + L+S+ + + F R IR+WN LPS V + Sbjct: 441 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNVVNQ 480 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 639 SRVHPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTVFTE 758 +R H + L+S+ + + F R IR+WN LPS V + Sbjct: 1427 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNVVNQ 1466 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 639 SRVHPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTVFTE 758 +R H + L+S+ + + F R IR+WN LPS V + Sbjct: 387 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNVVNQ 426 >SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) Length = 888 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +3 Query: 597 IPASHFYHRTARHRSRVHPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTV 749 +P S R HP + + + T F+ F+ R IRLWN L TV Sbjct: 713 LPLSTLSKPLRRSERTSHPEHYDIPYARTNIFKYSFVPRAIRLWNSLEVTV 763 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/79 (27%), Positives = 31/79 (39%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L +RR LC+ Y + L + F R+ Y ++S+ + Sbjct: 818 LEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVLSH 870 Query: 693 QRYFLLRTIRLWNELPSTV 749 F RTIR WN LPS V Sbjct: 871 SYSFFPRTIRTWNLLPSEV 889 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 29.5 bits (63), Expect = 3.2 Identities = 25/77 (32%), Positives = 32/77 (41%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L LRR L +LY + G+ + M H RT S YY E + + Sbjct: 79 LELRRTMARLTLLYKLSRGQIDIDT-SMYLRPHQDLRT--RNSHNFKYYQEKATKNKYFY 135 Query: 693 QRYFLLRTIRLWNELPS 743 F RTIR WN LP+ Sbjct: 136 S--FFPRTIRHWNTLPN 150 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/79 (27%), Positives = 31/79 (39%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L +RR LC+ Y + L + F R+ Y ++S+ + Sbjct: 98 LEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVLSH 150 Query: 693 QRYFLLRTIRLWNELPSTV 749 F RTIR WN LPS V Sbjct: 151 SYSFFPRTIRTWNLLPSEV 169 >SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) Length = 282 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 669 LRSSTVCFQRYFLLRTIRLWNELPSTVFTE 758 L+S+ + + F R IR+WN LPS V + Sbjct: 227 LQSNILSYNYSFFARAIRIWNLLPSNVVNQ 256 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 29.5 bits (63), Expect = 3.2 Identities = 25/77 (32%), Positives = 32/77 (41%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L LRR L +LY + G+ + M H RT S YY E + + Sbjct: 280 LELRRTMARLTLLYKLSRGQIDIDT-NMYLRPHQDLRT--RNSHNFKYYQEKATKNKYFY 336 Query: 693 QRYFLLRTIRLWNELPS 743 F RTIR WN LP+ Sbjct: 337 S--FFPRTIRHWNTLPN 351 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 29.5 bits (63), Expect = 3.2 Identities = 25/77 (32%), Positives = 32/77 (41%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L LRR L +LY + G+ + M H RT S YY E + + Sbjct: 266 LELRRTMARLTLLYKLSRGQIDIDT-SMYLRPHQDLRT--RNSHNFKYYQEKATKNKYFY 322 Query: 693 QRYFLLRTIRLWNELPS 743 F RTIR WN LP+ Sbjct: 323 S--FFPRTIRHWNTLPN 337 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/79 (27%), Positives = 31/79 (39%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L +RR LC+ Y + L + F R+ Y ++S+ + Sbjct: 143 LEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVLSH 195 Query: 693 QRYFLLRTIRLWNELPSTV 749 F RTIR WN LPS V Sbjct: 196 SYSFFPRTIRTWNLLPSEV 214 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 29.5 bits (63), Expect = 3.2 Identities = 25/77 (32%), Positives = 32/77 (41%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L LRR L +LY + G+ + M H RT S YY E + + Sbjct: 512 LELRRTMARLTLLYKLSRGQIDIDT-SMYLRPHQDLRT--RNSHNFKYYQEKATKNKYFY 568 Query: 693 QRYFLLRTIRLWNELPS 743 F RTIR WN LP+ Sbjct: 569 S--FFPRTIRHWNTLPN 583 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 29.5 bits (63), Expect = 3.2 Identities = 25/77 (32%), Positives = 32/77 (41%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L LRR L +LY + G+ + M H RT S YY E + + Sbjct: 486 LELRRTMARLTLLYKLSRGQIDIDT-NMYLRPHQDLRT--RNSHNFKYYQEKATKNKYFY 542 Query: 693 QRYFLLRTIRLWNELPS 743 F RTIR WN LP+ Sbjct: 543 S--FFPRTIRHWNTLPN 557 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/79 (27%), Positives = 31/79 (39%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L +RR LC+ Y + L + F R+ Y ++S+ + Sbjct: 405 LEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVLSH 457 Query: 693 QRYFLLRTIRLWNELPSTV 749 F RTIR WN LPS V Sbjct: 458 SYSFFPRTIRTWNLLPSEV 476 >SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 152 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/79 (27%), Positives = 31/79 (39%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L +RR LC+ Y + L + F R+ Y ++S+ + Sbjct: 52 LEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVLSH 104 Query: 693 QRYFLLRTIRLWNELPSTV 749 F RTIR WN LPS V Sbjct: 105 SYSFFPRTIRTWNLLPSEV 123 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/79 (27%), Positives = 31/79 (39%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L +RR LC+ Y + L + F R+ Y ++S+ + Sbjct: 509 LEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVLSH 561 Query: 693 QRYFLLRTIRLWNELPSTV 749 F RTIR WN LPS V Sbjct: 562 SYSFFPRTIRTWNLLPSEV 580 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 29.5 bits (63), Expect = 3.2 Identities = 25/77 (32%), Positives = 32/77 (41%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L LRR L +LY + G+ + M H RT S YY E + + Sbjct: 571 LELRRTMARLTLLYKLSRGQIDIDT-SMYLRPHQDLRT--RNSHNFKYYQEKATKNKYFY 627 Query: 693 QRYFLLRTIRLWNELPS 743 F RTIR WN LP+ Sbjct: 628 S--FFPRTIRHWNTLPN 642 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/77 (28%), Positives = 37/77 (48%) Frame = +3 Query: 510 PLGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVC 689 PL RR L + Y + + + ++ + I RT + RS + ++E L T Sbjct: 611 PLSKRRQDARLTLFYKAVNKKSALKIPDNID-----RRTRQLRSSLPDKFIE-LCPRTEA 664 Query: 690 FQRYFLLRTIRLWNELP 740 ++ F RTI+ WN+LP Sbjct: 665 YKNSFFCRTIKEWNKLP 681 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/79 (27%), Positives = 31/79 (39%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L +RR LC+ Y + L + F R+ Y ++S+ + Sbjct: 737 LEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVLSH 789 Query: 693 QRYFLLRTIRLWNELPSTV 749 F RTIR WN LPS V Sbjct: 790 SYSFFPRTIRTWNLLPSEV 808 >SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) Length = 1420 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 666 APGSMDELYSGGGRCDGKNEMPVSSQTIPQSTLHGTYSTKY 544 AP S+++ GGG C G+N +PV+ P L G T Y Sbjct: 770 APTSLEDFKWGGGPCLGENGVPVN----PNIALGGFEGTDY 806 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 28.7 bits (61), Expect = 5.7 Identities = 22/77 (28%), Positives = 34/77 (44%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L LRR L +LY + G+ + + H+ R R+ + Y + + F Sbjct: 183 LELRRTMARLTLLYKLSRGQIDIDTSTYLRP----HQDLRTRNSHNFKYYQEKATKNKYF 238 Query: 693 QRYFLLRTIRLWNELPS 743 +F RTIR WN LP+ Sbjct: 239 YSFFP-RTIRHWNTLPN 254 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 28.3 bits (60), Expect = 7.5 Identities = 21/79 (26%), Positives = 31/79 (39%) Frame = +3 Query: 513 LGLRRDFGSLCILYCMFHGECSEELFEMIPASHFYHRTARHRSRVHPYYLEPLRSSTVCF 692 L +RR LC+ Y + L + F R+ Y ++S+ + Sbjct: 184 LEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVLSH 236 Query: 693 QRYFLLRTIRLWNELPSTV 749 F RTIR WN LP+ V Sbjct: 237 SYSFFPRTIRTWNLLPAQV 255 >SB_26191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +3 Query: 648 HPYYLEPLRSSTVCFQRYFLLRTI-RLW 728 HPYY E + SS + F+ ++RTI R W Sbjct: 78 HPYYSERMLSSVLLFRENGIIRTIQREW 105 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +3 Query: 636 RSRVHPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTVFTERL 764 R HPYY E + SS + F+ ++RTI+ E T ++ER+ Sbjct: 103 REWYHPYYSERMLSS-ILFRENAIIRTIK--REWYHTYYSERI 142 >SB_8382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 882 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 164 QSRDKSPEVSADIPVELMEISKAMAPMTKEDGRKNRVLLEE 286 ++R SPE +A IP + +A + DGR N ++ EE Sbjct: 492 KNRATSPETAATIPCQRQGFFRAQDGPRRIDGRTNSLIQEE 532 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +3 Query: 648 HPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTVFTE 758 HP + T F+ F IR+WN LP + T+ Sbjct: 616 HPQRFALVSCKTNVFKESFFPHAIRMWNGLPVSTITQ 652 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +3 Query: 648 HPYYLEPLRSSTVCFQRYFLLRTIRLWNELPSTVFTE 758 HP + T F+ F IR+WN LP + T+ Sbjct: 198 HPQRFALVSCKTNVFKESFFPHAIRMWNGLPVSTITQ 234 >SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 27.9 bits (59), Expect = 9.9 Identities = 22/72 (30%), Positives = 34/72 (47%) Frame = +1 Query: 535 VPSVFCTVCSMESALRNCLR*YRHLIFTIAPPATGVEFIHTTWSHCGHPQCVSRGIFCYV 714 VP+V TV ++ S + N + +++F+ P G IH+T CG PQC C + Sbjct: 393 VPNVVFTVPNVVSTVPNVVSTVPNVVFS---PQCG---IHST--QCGSPQCGIHSTQCGI 444 Query: 715 PSGYGMSSPPRC 750 S P+C Sbjct: 445 HSTQCGIHSPQC 456 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,000,928 Number of Sequences: 59808 Number of extensions: 418938 Number of successful extensions: 1307 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 1219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1307 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -