BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00529 (790 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 25 2.0 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 25 2.0 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 25 2.0 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 24 4.7 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 24 4.7 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 8.1 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 424 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 458 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 211 IDGDLKGHGTDDKRGWEKKQSIIRRVLDEETGRYRL 318 + GD+ + T D+ + + RRVLD + GR RL Sbjct: 408 LSGDVNRYETGDEDNFSQATVFYRRVLD-DAGRQRL 442 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 24.2 bits (50), Expect = 4.7 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -3 Query: 296 SSNTLLIILCFFSHPLLSSVPWPLRSPSI 210 S +T + C+ ++ + +PWP SP + Sbjct: 167 SKHTSRTVKCYLANQDVQVLPWPALSPDL 195 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 24.2 bits (50), Expect = 4.7 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -3 Query: 296 SSNTLLIILCFFSHPLLSSVPWPLRSPSI 210 S +T + C+ ++ + +PWP SP + Sbjct: 239 SKHTSRTVKCYLANQDVQVLPWPALSPDL 267 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.4 bits (48), Expect = 8.1 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 574 HSPWNIQYKIQREPKSL 524 H PWN +QR K L Sbjct: 445 HEPWNASESVQRAAKCL 461 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 702,921 Number of Sequences: 2352 Number of extensions: 13938 Number of successful extensions: 48 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -