Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00528
         (505 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_06_0628 - 25643006-25643123,25643314-25643471,25643559-256436...    27   6.5  

>11_06_0628 -
           25643006-25643123,25643314-25643471,25643559-25643687,
           25644378-25644451,25644771-25644798
          Length = 168

 Score = 27.5 bits (58), Expect = 6.5
 Identities = 19/70 (27%), Positives = 31/70 (44%)
 Frame = +3

Query: 129 NPNPEETSETKSVEDFNVAANAMVETEAITPEPTYDKENVVAIFTLKNPKIFSLKFHLNT 308
           NP+ E   + + V+D  V    +V+T  +  +P +DK+  V  F  +  K  S K     
Sbjct: 48  NPSAEGGGDDEGVDDQAVKVVDIVDTFRLQEQPPFDKKQFVT-FMKRYIKNLSAKLDAEK 106

Query: 309 QCPLKLDCMG 338
           Q   K +  G
Sbjct: 107 QEEFKKNIEG 116


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,926,281
Number of Sequences: 37544
Number of extensions: 184302
Number of successful extensions: 427
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 419
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 427
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1071221400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)