BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdS00528
(505 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
11_06_0628 - 25643006-25643123,25643314-25643471,25643559-256436... 27 6.5
>11_06_0628 -
25643006-25643123,25643314-25643471,25643559-25643687,
25644378-25644451,25644771-25644798
Length = 168
Score = 27.5 bits (58), Expect = 6.5
Identities = 19/70 (27%), Positives = 31/70 (44%)
Frame = +3
Query: 129 NPNPEETSETKSVEDFNVAANAMVETEAITPEPTYDKENVVAIFTLKNPKIFSLKFHLNT 308
NP+ E + + V+D V +V+T + +P +DK+ V F + K S K
Sbjct: 48 NPSAEGGGDDEGVDDQAVKVVDIVDTFRLQEQPPFDKKQFVT-FMKRYIKNLSAKLDAEK 106
Query: 309 QCPLKLDCMG 338
Q K + G
Sbjct: 107 QEEFKKNIEG 116
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,926,281
Number of Sequences: 37544
Number of extensions: 184302
Number of successful extensions: 427
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 419
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 427
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1071221400
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -