BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00527 (736 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 6.9 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 6.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.9 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 9.1 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 6.9 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 448 SPPAKRSDE*IDAICN 401 +PP ++E +DA+CN Sbjct: 453 APPQLPTEESVDALCN 468 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.8 bits (44), Expect = 6.9 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -2 Query: 588 PSPPCARVRFGRSESCVHPPLLAAPSWCDYRQ 493 P P C G H PLLA PS+ + Q Sbjct: 332 PEPDCIHELLG------HMPLLADPSFAQFSQ 357 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.9 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 538 SPSTAGGTFLVRLQTTHHLKTAGTPQIQPYSP 443 S G F +R TT+HL+ +I P Sbjct: 932 SQQNVAGVFNLRPATTYHLRIVAENEIGASDP 963 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -1 Query: 94 NQRHFVVVDL*RCSLSFEDFSHLFQ 20 N+ V++D RCS+ + H F+ Sbjct: 199 NKNGSVILDTARCSMKWTLIEHAFE 223 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,204 Number of Sequences: 438 Number of extensions: 3989 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -