BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00526 (728 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g18040.1 68415.m02097 peptidyl-prolyl cis-trans isomerase (PI... 99 3e-21 At1g26550.1 68414.m03235 peptidyl-prolyl cis-trans isomerase PPI... 52 5e-07 At5g19370.1 68418.m02308 rhodanese-like domain-containing protei... 46 2e-05 At2g41020.2 68415.m05066 WW domain-containing protein contains P... 42 4e-04 At2g41020.1 68415.m05067 WW domain-containing protein contains P... 42 4e-04 At3g59770.1 68416.m06670 sacI homology domain-containing protein... 39 0.004 At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar... 37 0.012 At3g19670.1 68416.m02492 FF domain-containing protein / WW domai... 33 0.26 At3g19840.1 68416.m02513 FF domain-containing protein / WW domai... 31 0.78 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 31 0.78 At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical ... 31 0.78 At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical ... 31 0.78 At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical ... 31 0.78 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 31 0.78 At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar... 31 1.0 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 29 3.2 At3g32190.1 68416.m04102 hypothetical protein 28 5.5 At5g56550.1 68418.m07057 expressed protein 28 7.3 >At2g18040.1 68415.m02097 peptidyl-prolyl cis-trans isomerase (PIN1) / cyclophilin / rotamase identical to Chain A, Solution Structure Of Pin1at From Arabidopsis Thaliana GI:22218833; contains Pfam profile PF00639: PPIC-type PPIASE domain Length = 119 Score = 99.1 bits (236), Expect = 3e-21 Identities = 45/89 (50%), Positives = 63/89 (70%), Gaps = 4/89 (4%) Frame = +1 Query: 256 VRCSHLLVKHSGSRRPSSWREEH----ITRTKEEALDILQEYRRKIIDREAKFEELASTY 423 V+ SH+L+KH GSRR +SW++ +T T+E A++ L+ R I+ +A FEE+A+ Sbjct: 7 VKASHILIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRV 66 Query: 424 SDCSSAKRDGDLGRFKKGQMQKPFEDVAF 510 SDCSSAKR GDLG F +GQMQKPFE+ + Sbjct: 67 SDCSSAKRGGDLGSFGRGQMQKPFEEATY 95 Score = 35.9 bits (79), Expect = 0.028 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +3 Query: 459 GSFQERSNAETI*RRRISLKIGQLSQPVHTDSGIHIILRTA 581 GSF + +LK+G +S V TDSG+HII RTA Sbjct: 79 GSFGRGQMQKPFEEATYALKVGDISDIVDTDSGVHIIKRTA 119 >At1g26550.1 68414.m03235 peptidyl-prolyl cis-trans isomerase PPIC-type family protein similar to SP|Q9Y237 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 (EC 5.2.1.8) (Rotamase Pin4) (PPIase Pin4) (Parvulin 14) {Homo sapiens}; contains Pfam profile PF00639: PPIC-type PPIASE domain Length = 142 Score = 51.6 bits (118), Expect = 5e-07 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = +1 Query: 394 AKFEELASTYSDCSSAKRDGDLGRFKKGQMQKPFEDVAF 510 A+F ++A+ YS+C S K+ GDLG F +G+M PF+DVAF Sbjct: 77 AEFAKIAAEYSECPSGKKGGDLGWFPRGKMAGPFQDVAF 115 >At5g19370.1 68418.m02308 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein low similarity to MPT-synthase sulfurylase [Synechococcus sp. PCC 7942] GI:2950364; contains Pfam profiles PF00581: Rhodanese-like domain, PF00639: PPIC-type PPIASE domain; identical to cDNA peptidyl-prolyl cis-trans isomerase GI:2246379 Length = 299 Score = 46.4 bits (105), Expect = 2e-05 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 3/78 (3%) Frame = +1 Query: 286 SGSRRPSSWRE---EHITRTKEEALDILQEYRRKIIDREAKFEELASTYSDCSSAKRDGD 456 SGS S+ RE +H+ K +++ E ++K +D E + +LA+ YS C S K G Sbjct: 85 SGSSGSSASREILVQHLL-VKNNDVELFAELQKKFLDGE-EMSDLAAEYSICPSKKDGGI 142 Query: 457 LGRFKKGQMQKPFEDVAF 510 LG K GQM FE+ AF Sbjct: 143 LGWVKLGQMVPEFEEAAF 160 >At2g41020.2 68415.m05066 WW domain-containing protein contains Pfam domain PF00397: WW domain Length = 382 Score = 41.9 bits (94), Expect = 4e-04 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +2 Query: 101 LPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 193 LP GW K ++G TYY N+HT QWE+P Sbjct: 194 LPLGWVDAKDPASGATYYYNQHTGTCQWERP 224 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 56 PAQRTNDMASTQEEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 193 P + + +S + E W ++G Y+ N T SQWE P Sbjct: 224 PVELSYATSSAPPVLSKEEWIETFDEASGHKYFYNTRTHVSQWEPP 269 >At2g41020.1 68415.m05067 WW domain-containing protein contains Pfam domain PF00397: WW domain Length = 463 Score = 41.9 bits (94), Expect = 4e-04 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +2 Query: 101 LPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 193 LP GW K ++G TYY N+HT QWE+P Sbjct: 194 LPLGWVDAKDPASGATYYYNQHTGTCQWERP 224 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 56 PAQRTNDMASTQEEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 193 P + + +S + E W ++G Y+ N T SQWE P Sbjct: 224 PVELSYATSSAPPVLSKEEWIETFDEASGHKYFYNTRTHVSQWEPP 269 >At3g59770.1 68416.m06670 sacI homology domain-containing protein / WW domain-containing protein contains Pfam profiles PF00397: WW domain, PF02383: SacI homology domain; identical to cDNA SAC domain protein 9 (SAC9) GI:31415734 Length = 1630 Score = 38.7 bits (86), Expect = 0.004 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +2 Query: 101 LPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 193 LP GWE R TG +YY++ +TK + W P Sbjct: 510 LPPGWEKRADAVTGKSYYIDHNTKTTTWSHP 540 >At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 1088 Score = 37.1 bits (82), Expect = 0.012 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 89 QEEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKPGGP 202 ++ LP+ W+ STG+ YY N T +Q+E+P P Sbjct: 18 EDPTLPQPWKGLIDGSTGILYYWNPETNVTQYERPSAP 55 >At3g19670.1 68416.m02492 FF domain-containing protein / WW domain-containing protein weak similarity to huntingtin-interacting protein HYPA/FBP11 [Homo sapiens] GI:3341980; contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 960 Score = 32.7 bits (71), Expect = 0.26 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +2 Query: 140 GMTYYLNKHTKKSQWEKP 193 G Y+ NK TKKS WEKP Sbjct: 217 GRKYFFNKRTKKSTWEKP 234 >At3g19840.1 68416.m02513 FF domain-containing protein / WW domain-containing protein weak similarity to transcription factor CA150b [Mus musculus] GI:6329166; contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 743 Score = 31.1 bits (67), Expect = 0.78 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +2 Query: 107 EGWEARKSRSTGMTYYLNKHTKKSQWEKPGG 199 + W A KS + G+ YY N T +S +EKP G Sbjct: 157 DAWTAHKSEA-GVLYYYNSVTGQSTYEKPPG 186 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 98 ILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 193 ILP A S + G YY N TK S W+ P Sbjct: 203 ILPGTDWALVSTNDGKKYYYNNKTKVSSWQIP 234 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 31.1 bits (67), Expect = 0.78 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 101 LPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 193 LP W+A ST YY N T ++ W +P Sbjct: 831 LPSEWQAYWDESTKKVYYGNTSTSQTSWTRP 861 >At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical to RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 619 Score = 31.1 bits (67), Expect = 0.78 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 89 QEEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 193 ++ LP+ W+ TG Y+ N T +Q+EKP Sbjct: 15 EDHTLPKPWKGLIDDRTGYLYFWNPETNVTQYEKP 49 >At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical to RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 619 Score = 31.1 bits (67), Expect = 0.78 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 89 QEEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 193 ++ LP+ W+ TG Y+ N T +Q+EKP Sbjct: 15 EDHTLPKPWKGLIDDRTGYLYFWNPETNVTQYEKP 49 >At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical to RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 618 Score = 31.1 bits (67), Expect = 0.78 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 89 QEEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 193 ++ LP+ W+ TG Y+ N T +Q+EKP Sbjct: 15 EDHTLPKPWKGLIDDRTGYLYFWNPETNVTQYEKP 49 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 31.1 bits (67), Expect = 0.78 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 149 YYLNKHTKKSQWEKP 193 YY NK TK+S WEKP Sbjct: 213 YYYNKRTKQSNWEKP 227 >At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 713 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 101 LPEGWEARKSRSTGMTYYLNKHTKKSQWEKPGGPA 205 LP+ W+ TG Y+ N T +Q+E+P A Sbjct: 17 LPKPWKGLVDSRTGYLYFWNPETNVTQYERPASSA 51 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/60 (21%), Positives = 28/60 (46%) Frame = +1 Query: 262 CSHLLVKHSGSRRPSSWREEHITRTKEEALDILQEYRRKIIDREAKFEELASTYSDCSSA 441 CS L + + R + W +E +T + ++ + + + AK ++ Y +CSS+ Sbjct: 180 CSRLSQEKELTERHAKWLDEELTAKVDSYAELRRRHSDLESEMSAKLVDVEKNYIECSSS 239 >At3g32190.1 68416.m04102 hypothetical protein Length = 358 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 322 HITRTKEEALDILQEYRRKIIDRE 393 H +RT E D++Q Y R ++DRE Sbjct: 47 HSSRTNSELNDMIQYYERLLLDRE 70 >At5g56550.1 68418.m07057 expressed protein Length = 172 Score = 27.9 bits (59), Expect = 7.3 Identities = 19/63 (30%), Positives = 25/63 (39%) Frame = +1 Query: 319 EHITRTKEEALDILQEYRRKIIDREAKFEELASTYSDCSSAKRDGDLGRFKKGQMQKPFE 498 E TR +EE DI+QE D E + + S CS D D P E Sbjct: 18 EDPTRIQEEE-DIVQEVSTTFSDEEDNSSSCSLSSSMCSDFTEDDDDDDVSSSSSNGPLE 76 Query: 499 DVA 507 D++ Sbjct: 77 DLS 79 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,806,508 Number of Sequences: 28952 Number of extensions: 284803 Number of successful extensions: 782 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -