BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00525 (699 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41034-4|AAY43995.1| 385|Caenorhabditis elegans Hypothetical pr... 29 2.4 AF125959-3|AAD14731.1| 531|Caenorhabditis elegans Udp-glucurono... 28 5.6 AC006795-2|AAF59493.3| 421|Caenorhabditis elegans Hypothetical ... 28 7.4 AC024753-1|AAF60456.1| 732|Caenorhabditis elegans Hypothetical ... 27 9.8 >U41034-4|AAY43995.1| 385|Caenorhabditis elegans Hypothetical protein M02D8.7 protein. Length = 385 Score = 29.5 bits (63), Expect = 2.4 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +3 Query: 435 YLNIICFNVNGLCEISVDRFCIIILSLK-IKFSRIWIFIYLMILFISKQRELF 590 Y +I+ + + ++ D F I L+LK I FS++ FIYL I + QR++F Sbjct: 271 YFHIVLPSYKDMMDLISDTF--IRLNLKGIDFSQVRFFIYLFIKTETLQRQIF 321 >AF125959-3|AAD14731.1| 531|Caenorhabditis elegans Udp-glucuronosyltransferase protein14 protein. Length = 531 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 341 VRSVVYVILYVPCAILKFYSLKRIIIFHMVFLFKHYMF 454 V+++VY +L+ F S K I+IF+ +F F H F Sbjct: 3 VKTLVYFLLFTG-----FISCKNILIFNPIFAFSHVKF 35 >AC006795-2|AAF59493.3| 421|Caenorhabditis elegans Hypothetical protein Y50D4B.6 protein. Length = 421 Score = 27.9 bits (59), Expect = 7.4 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 492 FCIIILSLKIKFSRIWIFIYL 554 +CI++++L + F +W F YL Sbjct: 11 YCIVVIALSVLFYYVWKFYYL 31 >AC024753-1|AAF60456.1| 732|Caenorhabditis elegans Hypothetical protein Y23H5B.6 protein. Length = 732 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 153 EHMKNFKISRTKKFMRPITKVSSSPQCIYVKL 58 E + N IS+TK + +TKVS++ + + KL Sbjct: 579 EKISNITISKTKPLKKAVTKVSAAKKILNKKL 610 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,296,902 Number of Sequences: 27780 Number of extensions: 240480 Number of successful extensions: 556 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -