BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00524 (569 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2557| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_2557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 627 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -3 Query: 348 YKKLISKHLWTFKGTLFLFNLH 283 ++++ISKHLWT T F+ N++ Sbjct: 225 WEEIISKHLWTAVSTHFIENIY 246 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -2 Query: 538 NDT*VQYTSICFSPCPYN*IWNVSHCFASISLLCS 434 N T Q + F+PCP N W+ ++ S CS Sbjct: 828 NGTNAQSRTCAFAPCPVNGAWSSWSAWSDCSKTCS 862 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,399,088 Number of Sequences: 59808 Number of extensions: 304706 Number of successful extensions: 622 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -