BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00521 (680 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0121 - 833885-833949,834180-834430,834545-834604,834893-83... 31 0.64 01_03_0010 - 11608537-11608786,11608816-11608940,11609152-116092... 31 0.64 12_02_0291 + 16951154-16952740 29 4.5 11_02_0045 - 7705728-7707581 28 6.0 07_03_1000 - 23220878-23221821,23222164-23223001 28 6.0 01_01_1060 - 8363272-8365912,8366375-8366443,8366479-8366843,836... 28 6.0 05_06_0277 + 26885621-26886064,26886148-26886317,26887038-268879... 28 7.9 >05_01_0121 - 833885-833949,834180-834430,834545-834604,834893-834926, 835746-835805,836409-836509,836939-837039,837209-837289, 837580-837650,837738-837849,838138-838173,838865-838951, 839055-839396 Length = 466 Score = 31.5 bits (68), Expect = 0.64 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +2 Query: 539 ATIRGNSFFGVRHGLETLSQLIVYD-DIRN 625 ATI N+ +G GLET SQL V++ D +N Sbjct: 140 ATIEANTIYGAIRGLETFSQLCVFNYDTKN 169 >01_03_0010 - 11608537-11608786,11608816-11608940,11609152-11609217, 11609741-11609872,11610507-11610608,11610743-11610940, 11611015-11611161,11611321-11611431,11613241-11613780, 11613847-11614003,11614148-11614297,11614375-11614514, 11615346-11615468,11615561-11615677,11617184-11617357, 11617768-11617909,11618076-11618194,11619773-11619955 Length = 991 Score = 31.5 bits (68), Expect = 0.64 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +2 Query: 185 RSLSSVWKPARCS-VTIMVSSGRNHDRDKSG*LPLQD*YEHHRHSDHQARKERRPPHSGC 361 + LSS+ PA C + +++ +H +G L L +H HSDH + + P Sbjct: 482 QKLSSLKAPASCQDIPLLLPHEPDHQASNNGELGLNGLDNNHGHSDHPNKTHWKQPIPNR 541 Query: 362 RQV*DTGFQ 388 + DT Q Sbjct: 542 KAKQDTSLQ 550 >12_02_0291 + 16951154-16952740 Length = 528 Score = 28.7 bits (61), Expect = 4.5 Identities = 30/121 (24%), Positives = 48/121 (39%), Gaps = 4/121 (3%) Frame = +1 Query: 139 CENNRCTKIRNEPENKEPVLSLEACKMFCDDYGLLWPKPRSRQ--IWVTSSPRLI*TPST 312 C N R I EN+E V S + +M + L PK + I VT P P Sbjct: 92 CNNGRDDPIVTLDENQEVVDSFDGARM----WWRLCPKASKNKGAITVTYYPGEADKPRC 147 Query: 313 FR--SPSKERATTSSQRLPTGLRHWFPVPCLKASRRRLQENQSQFI*SMTILISENSPWT 486 F+ + R + LP+ +R W + + RR + ++ S+ + N P T Sbjct: 148 FKLVFHKRHRQLVLNSYLPSVVRRWRELTAMNRQRRLFTNHANEAKKSVWTSVPYNPPAT 207 Query: 487 W 489 + Sbjct: 208 F 208 >11_02_0045 - 7705728-7707581 Length = 617 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = +1 Query: 58 ICIYSVFIIIECGIPTAAEEHSLWRWTCENNRCTKIRNEPENKEPVLSLEACKMFCDD 231 +C +++ ++ GIP E + L RWT N + + P N + L+ C C D Sbjct: 524 LCRHALRVLTAIGIPVLPENYILKRWT-RNAKNNILSQVPANTKGSLAWR-CNDLCRD 579 >07_03_1000 - 23220878-23221821,23222164-23223001 Length = 593 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 539 ATIRGNSFFGVRHGLETLSQLIVYDDIRNNLLIVRDVTIKDR 664 AT+ + +G GLET SQL + +L+ V ++DR Sbjct: 143 ATVTAATAWGAMRGLETFSQLAWWCGRERAVLVAAGVRVEDR 184 >01_01_1060 - 8363272-8365912,8366375-8366443,8366479-8366843, 8367403-8367550,8367630-8367873,8368105-8368407, 8368639-8368851,8368927-8369002,8369533-8369561, 8369610-8369984,8371784-8371927,8374053-8374086 Length = 1546 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/58 (34%), Positives = 28/58 (48%) Frame = +3 Query: 303 TIDIQITKQGKSDDLLTAAADRFKTLVSSSVPKGFSAKAAGKSVTVYLVNDNPYIREF 476 T D +T GKS + AAAD +T++ SS+P + TVY NP R + Sbjct: 722 TNDTWLTDSGKSS--IMAAADELETMLPSSIP--YMTARVFTMDTVYNFTVNPRDRHW 775 >05_06_0277 + 26885621-26886064,26886148-26886317,26887038-26887941, 26888544-26888575,26888862-26888928,26889116-26889173, 26889329-26889421,26890366-26890480,26890847-26890894, 26891012-26891057,26891161-26891231,26891865-26891870, 26891991-26892038,26892439-26892488,26892892-26893154 Length = 804 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 307 STFRSPSKERATTSSQRLPTGLRHWFPVPCLKASRRR 417 S RSP+++R + +R P R P P ++ RRR Sbjct: 224 SRSRSPARDRGSPPRRRSPPARRERSPAPRSRSPRRR 260 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,937,055 Number of Sequences: 37544 Number of extensions: 420106 Number of successful extensions: 1156 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1155 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -