BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00519 (755 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0475 + 9724676-9724936,9725518-9726216,9726273-9726596,972... 29 4.0 06_03_0434 + 20725996-20726026,20726300-20726947,20727168-207272... 29 4.0 >09_02_0475 + 9724676-9724936,9725518-9726216,9726273-9726596, 9726900-9727847 Length = 743 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -3 Query: 216 KVLRSNRQPGDDSAILIYGILGLLKSTLLSFHYQEKEQG 100 K L S P D S + I G+ GL K++L +++KE+G Sbjct: 130 KDLLSQSNPDDLSILPIVGLPGLGKTSLARLVFEDKEEG 168 >06_03_0434 + 20725996-20726026,20726300-20726947,20727168-20727230, 20727300-20727458,20727750-20728247,20729068-20729321, 20729448-20729829,20729938-20730204,20730530-20730789 Length = 853 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 635 KKKPRKFVEVNTNYKLRKNRPSPKS 709 K+K K +VN NY LR+N PS S Sbjct: 125 KEKQAKIDKVNANYALRRNTPSEYS 149 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,070,985 Number of Sequences: 37544 Number of extensions: 278780 Number of successful extensions: 481 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -