BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00517 (762 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 25 0.66 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 24 1.5 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 2.7 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 22 4.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.1 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 25.0 bits (52), Expect = 0.66 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 454 IIANQCSKNKGIQSASYTVPKGKKVLKG 537 IIA Q +++ + S YTVP G V+ G Sbjct: 64 IIARQLNQDLKLASGDYTVPAGCTVVIG 91 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 310 DAQLFGTILKYAPVEDSLFVKLGPQIEPSICPN 408 D Q GTI P + ++F++ G + S+CP+ Sbjct: 217 DNQCSGTIDWALPNKRTVFIRKGGTAKASMCPS 249 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 604 PAPKSVARPITEDERTSKLIIP 669 PAP+S A PI+ TS P Sbjct: 13 PAPQSAATPISSSGMTSPAAAP 34 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 Query: 98 YFCAVLGKTPTSKW 139 +FC LG P KW Sbjct: 313 HFCRTLGSLPPFKW 326 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 8.1 Identities = 6/15 (40%), Positives = 8/15 (53%) Frame = +1 Query: 169 HFHKDWQRFVKTWFN 213 H H DW TW++ Sbjct: 1030 HMHPDWTTKPSTWWS 1044 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 424 YSNSNRSGKYWVQSAALISRRVNPLP 347 Y N+N S YW++ A + V +P Sbjct: 2539 YFNANFSLNYWIEKGADPGKIVMGMP 2564 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,162 Number of Sequences: 336 Number of extensions: 3475 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -