BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdS00512
(712 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC6G10.07 |||nuclear cap-binding complex large subunit |Schizo... 27 2.6
>SPAC6G10.07 |||nuclear cap-binding complex large subunit
|Schizosaccharomyces pombe|chr 1|||Manual
Length = 780
Score = 27.1 bits (57), Expect = 2.6
Identities = 10/33 (30%), Positives = 21/33 (63%)
Frame = +2
Query: 188 WMKYKLSLL*KKIEFNFLIKKLNYLKRREDPIE 286
W+ + L+L+ K +E NFL K + ++ +P++
Sbjct: 711 WVSHWLNLMLKYVESNFLSVKKDTIEEANEPVQ 743
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,272,305
Number of Sequences: 5004
Number of extensions: 38850
Number of successful extensions: 62
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 62
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 62
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 331187010
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -