BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00511 (728 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30410.1 68415.m03704 tubulin folding cofactor A (KIESEL) ide... 47 1e-05 At5g56930.1 68418.m07107 zinc finger (CCCH-type) family protein ... 29 2.4 At1g15730.1 68414.m01887 PRLI-interacting factor L, putative str... 28 7.3 >At2g30410.1 68415.m03704 tubulin folding cofactor A (KIESEL) identical to cDNA tubulin folding cofactor A, GI:20514256, SP|O04350 Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A homolog) {Arabidopsis thaliana} Length = 113 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/61 (37%), Positives = 34/61 (55%) Frame = +1 Query: 73 IRQIKIKTGVVKRIXXXXXXXXXXXXLQKNRIQRIKDEGQDEHNIRKQEEVLQESLMMVP 252 IR +KIKT KRI + + +KD+G D +++++QE VL ES MM+P Sbjct: 4 IRNLKIKTSTCKRIVKELHSYEKEVEREAAKTADMKDKGADPYDLKQQENVLGESRMMIP 63 Query: 253 D 255 D Sbjct: 64 D 64 >At5g56930.1 68418.m07107 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 675 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -3 Query: 597 RCSPCCGETCACCILGDIC-FDDD 529 +CSPCC C+ GD C FD D Sbjct: 381 KCSPCCYFATQSCMKGDDCPFDHD 404 >At1g15730.1 68414.m01887 PRLI-interacting factor L, putative strong similarity to PRLI-interacting factor L GI:11139268 from [Arabidopsis thaliana]; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 448 Score = 27.9 bits (59), Expect = 7.3 Identities = 8/33 (24%), Positives = 16/33 (48%) Frame = +3 Query: 510 RQPQHKSRHQNKCHQEYNKHKFRHSKDYIDGHE 608 R+ H + CH +N+H+ H ++ H+ Sbjct: 314 REGHDDHHHGHDCHDHHNEHEHEHEHEHHHSHD 346 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,250,274 Number of Sequences: 28952 Number of extensions: 181237 Number of successful extensions: 654 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -